KEGG   Sinorhizobium meliloti 1021: SMa0085Help
Entry
SMa0085           CDS       T00058                                 

Definition
(RefSeq) dehydrogenase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 1235268
NCBI-ProteinID: NP_435289
RhizoBase: SMa0085
UniProt: Q931A1
Structure
PDB: 

Position
pSymA:45099..46052
Genome map
AA seq 317 aa AA seqDB search
MEFRNVKPDLLLVEPMMPFVMDELQRNYSVHRLYQAADRPALEAALPSIRAVATGGGAGL
SNEWMEKLPSLGIIAINGVGTDKVDLARARRRNIDVTTTPGVLADDVADLGIALMLAVLR
RVGDGDRLVREGRWAAGEQLPLGHSPKGKRIGVLGLGQIGRALASRAEAFGMSVRYWNRS
TLSGVDWIAHQSPVDLARDSDVLAVCVAASAATQNIVDASLLQALGPEGIVVNVARGNVV
DEDALIEALKSGTIAGAGLDVFVNEPAIRSEFHTTPNTVLMPHQGSATVETRMAMGKLVL
ANLAAHFAGEKAPNTVN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggagtttcgaaacgtgaaaccagatctattgctcgtagagccgatgatgccgttcgtc
atggacgaactgcagcggaattattcggttcacaggctttaccaggccgccgatcggccg
gcgctcgaagcggcactcccatcgatccgcgcggttgccacgggcggcggcgcgggcctt
tccaatgaatggatggagaagcttccatcactggggatcattgcaatcaacggggtcggg
acggacaaggtggatctcgcccgggcgcgccgtcgcaacatcgatgtgacgacgacgccg
ggtgtcctcgcggacgacgtcgctgacctcggtatcgcgctcatgctcgccgtcctgcgg
agggtcggcgatggcgacaggctggtgcgcgaaggccgctgggccgctggcgaacaacta
ccgctcggccatagcccgaagggaaagcggatcggcgtactcggcctcggtcagatcggg
cgggcactggcgtcgcgcgcggaggccttcggcatgtcggtgcgatactggaaccggtcc
accctttccggcgtcgactggatcgcgcatcagagcccggtcgacctcgcgcgcgacagc
gacgttctggccgtctgcgtggcggcgagtgcggcgacgcagaacatcgtcgacgcgtcc
cttcttcaggcgctcggtcccgagggtatcgtggtaaacgtcgcgcgtggcaacgtcgtc
gacgaggacgccctgatcgaagcgttgaagtccggaacgatcgcgggtgccgggctcgat
gtcttcgtgaacgaacccgcaatccgcagcgaattccataccacgccgaatacggtgctc
atgccgcatcagggcagcgcgaccgttgagacgcgcatggctatgggaaagctcgtgctt
gcaaatctcgccgcccactttgccggcgaaaaagcgccgaacaccgtcaattga

DBGET integrated database retrieval system