KEGG   Sinorhizobium meliloti 1021: SMa0510Help
Entry
SMa0510           CDS       T00058                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1235088
NCBI-ProteinID: NP_435514
RhizoBase: SMa0510
UniProt: Q930D0
Position
pSymA:275787..276734
Genome map
AA seq 315 aa AA seqDB search
MPKIELLQVGPYPSWDEERLNANFTMHRYFEAADKAAFLAEHGAAIRGIATRGELGANWA
MIEALPRLEIISVYGVGYDAVDLAAARERGIRVTNTPDVLTKDVADLGVAMMLAHARGMI
GGETWVKSGDWAKKGLYPLKRRVHGKRAGVLGLGRIGFEVAKRLAGFDMEIAYSDTGAKD
FARDWSFIADPVELAARSDFLFVTLAASAETRHIVGRRVIEALGPDGMLINISRASNIDE
EALLDALESKVLGAAALDVFEGEPNLNPRFLALDNVLLQPHMASGTAETRKAMGQLVFDN
LSAHFGGRPLPTPVL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatcgagctattgcaggttggcccgtacccttcatgggacgaggagcgtctg
aatgcgaacttcaccatgcaccgctatttcgaggcggcggacaaagcggcgttcctcgcc
gagcatggcgcagccatccgcggcattgccacacgcggcgagcttggtgccaactgggcg
atgatcgaggcgctgcccaggctggagatcatctcggtctatggcgtcggctacgacgcg
gtcgacttggctgcggcgcgtgagcgtggcatccgcgtcaccaatacgcccgacgtcttg
accaaggacgtcgccgacctcggcgtcgcgatgatgctggcgcatgcgcggggcatgatc
ggcggcgagacctgggtgaagagcggcgactgggcgaagaagggcctctatccgctgaag
cgccgcgtccacggcaagcgcgccggcgtgctcggccttggccgcatcggcttcgaggtg
gcaaaacgccttgccggcttcgacatggagatcgcctatagcgataccggtgcgaaggat
tttgccagggactggagcttcattgccgatccggtcgagcttgccgcccgctccgacttc
ctgttcgtgacgctcgcggcgtctgccgagacgcgtcatatcgtcgggcgcagggtcatc
gaggcgctcgggccggacggcatgctgatcaacatctcgcgcgcctccaacatcgacgag
gaagccctgctggacgcgctcgaaagcaaggtgctcggtgctgccgcgctcgacgtcttc
gagggcgagccgaaccttaatccgcgcttcctggcgctcgacaatgtgctgctgcagccg
cacatggcctccggcaccgcggagacccgcaaggcgatgggccagctcgtcttcgacaac
ctgtcggcccatttcggcggccggccgttgccaactccggttctgtga

DBGET integrated database retrieval system