KEGG   Sinorhizobium meliloti 1021: SMa1266Help
Entry
SMa1266           CDS       T00058                                 

Gene name
hemN
Definition
(RefSeq) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00860  Porphyrin and chlorophyll metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMa1266 (hemN)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     SMa1266 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-GeneID: 1235727
NCBI-ProteinID: NP_435937
RhizoBase: SMa1266
UniProt: Q92Z19
Position
pSymA:692476..693828
Genome map
AA seq 450 aa AA seqDB search
MQPALVAKYGEARLPRYTSYPTAPRFSPAIDANTYGDWLADIAPKQPASLYLHIPFCRSM
CWYCGCHTTITQRDQPILDYLDMLREEVHLVSAKTRAPLSIDHVHFGGGTPTIMQPEEFR
ALVALLRERFEFASMTEIAVEIDPRTLEPDMATALGEAGVRRASLGVQSFDPVVQKAINR
IQSEEQTMEAVSRLRQSGVDSINFDLIYGLPHQTVESCIATAEAAIRMGPERFAVFGYAH
IPSFKKHQKLIDEQALADAEGRVAQAEAIAATLAAAGYRRIGLDHFALPDDSLAIAQASG
RLHRNFQGYTTDACETLIGLGASAIGRTNDGYVQNEVPPGLYAQHIASGRLATVKGYRMT
PEDRLRAGIIERLMCDFGVDVPALATAHGFDPEMLLRGNTRLAMLESDGILDIADGVIRL
REGRRFLIRAAAAAFDAYIEQSGRTHSKAA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccggctcttgtcgccaaatatggcgaggcgcgcctgccccgttacacgagctat
ccgacggcgccccgcttttcacccgccatcgacgccaacacctatggcgactggctcgcc
gacatcgcaccaaagcagccggcgtcgctgtacctgcacattcccttttgtcgttcgatg
tgctggtactgcggctgtcataccacgatcacccaacgcgaccagccgatcctcgattat
ctcgacatgcttcgcgaggaggtccatctagtgtctgcaaagacgcgagcgccgcttagc
atcgaccacgtgcatttcggcggggggactccgactatcatgcagccggaggagttccgg
gcgctggtagcactgctgcgcgagcggttcgagttcgcgagcatgaccgaaatcgccgtg
gagatcgacccgcgaaccctcgagccggacatggcgacggccctcggcgaagccggtgtc
cgcagggcgagcctcggggtgcagagcttcgaccccgtcgtgcagaaggcgatcaaccgg
atccagagcgaggagcagacgatggaggccgtttcgcgcctgcgtcagtccggcgtcgac
agcatcaatttcgatctcatctacggcctgccgcatcagacagtcgaatcctgcatcgcg
accgccgaggcggcgatccggatgggacccgagcgcttcgccgtcttcggctacgcccac
atcccatcgttcaagaagcaccagaagctgatcgacgagcaggcgcttgccgacgcggaa
ggccgcgtcgcccaggccgaggccatagcggcgacactcgccgccgccggctaccgccgc
atcggactcgatcatttcgccctgccggacgacagcctggcgatcgcgcaggcgagcggt
cgattgcaccgcaatttccagggctacacgaccgatgcctgcgaaaccctcatcggcctc
ggcgcctcggcgatcgggcggacgaacgacggttatgtgcagaacgaggtgccgccgggc
ctctacgcccaacacatagcctcgggtcggcttgcaacggtgaaaggctaccggatgacg
cccgaggatagactgcgggcaggcatcatcgagcggctgatgtgcgacttcggcgtcgat
gttcccgcccttgccaccgcgcacgggttcgatccggagatgctgctccgcggcaacacc
aggctcgctatgctggaaagtgatggcatccttgatatcgctgacggcgtcatacggctg
cgcgaggggcgacgcttccttatccgcgccgccgctgcagccttcgacgcctatatcgaa
caatcgggacggacgcatagcaaggcggcgtga

DBGET integrated database retrieval system