KEGG   Sinorhizobium meliloti 1021: SMa1306
Entry
SMa1306           CDS       T00058                                 
Symbol
virB9
Name
(GenBank) VirB9 type IV secretion protein
  KO
K03204  type IV secretion system protein VirB9
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMa1306 (virB9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sme02044]
    SMa1306 (virB9)
Secretion system [BR:sme02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   SMa1306 (virB9)
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: AAK65369
RhizoBase: SMa1306
UniProt: Q92Z01
Position
pSymA:complement(713420..714274)
AA seq 284 aa
MRTTFIATLLLTAAAPTALALEIPRGATQDSRVRFVDYQPYNITRIIGSLRSSVQVEFAP
DEEIAHVALGNSVAWEVAPAGNILFLKPRENQPVTNISVVTTRRDGSTRSYQMELTVRDG
KVEVGQNTYFYVKYRYPADEAERRRQAAAARAIAAQAKEADNVLAIHEAYGPRNWRYSAQ
GAQALEPQSVYDNGKVTTFAFVGNQEMPAIYIENSDGSESLVPKSVDGNLVLVHAISRKF
ILRRGGDVLCVFNEAYDRVGINPDTSTTSPSVERIVRIDAGAVQ
NT seq 855 nt   +upstreamnt  +downstreamnt
atgcggactactttcatcgccaccctccttcttacggccgccgcccccacggcgcttgcc
ctcgaaatcccgcgcggcgcgacgcaggacagccgcgtccgtttcgtcgactaccagccc
tacaacatcacccgcatcatcggctcgctgcgctcctcggtgcaggtggagttcgcgccc
gacgaggagatcgcccatgtcgcgctcggcaacagtgtggcctgggaggtcgccccagcg
ggcaacatcctgtttctcaaaccgcgggaaaatcagccggtcaccaatatctccgtcgtg
accacccggcgcgacggatcaacccgaagctaccagatggagctgacggtacgggatgga
aaggtggaggtcggccagaacacctacttttacgtcaagtaccgatatcccgccgacgaa
gccgaacgcaggcgacaggccgcggcggcgcgagcgatcgccgcccaggcgaaggaagcc
gacaacgtgctggccattcatgaagcctatgggccgcggaactggcgctattcggcgcaa
ggcgcacaggcgctggaaccgcaatcggtctacgacaatggcaaggtcacgacctttgcc
ttcgttggcaatcaggaaatgccggccatctacatcgagaactcggacggcagtgagagc
ctggttcccaagtctgtcgacggcaacctggtgctggtacacgcgatcagccgcaagttc
atccttcggaggggaggggacgttctttgcgtctttaacgaagcctacgaccgcgtcggc
atcaatccggatactagcacgacctcgccctccgtcgagcggatcgtgcggatcgacgcc
ggagcggtgcaatag

DBGET integrated database retrieval system