KEGG   Sinorhizobium meliloti 1021: SMa1310
Entry
SMa1310           CDS       T00058                                 

Gene name
virB7
Definition
(GenBank) VirB7-like protein
  KO
K03202  type IV secretion system protein VirB7
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMa1310 (virB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sme02044]
    SMa1310 (virB7)
Secretion system [BR:sme02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   SMa1310 (virB7)
SSDB
Motif
Pfam: Imm1
Other DBs
NCBI-ProteinID: AAK65371
RhizoBase: SMa1310
UniProt: Q92YZ9
Position
pSymA:complement(714950..715264)
AA seq 104 aa
MTLFARTRERLSRINQNVPLLCVAAILSGCASMTYPLPKCDGYSRRPLNRSMWQWEDNSN
FKLKQSDARPAASQSVATAYAGEGREFPAFAHLDIDASYRPCEG
NT seq 315 nt   +upstreamnt  +downstreamnt
atgacgcttttcgcacgaacaagagaaaggctttccaggattaatcagaacgttccgctg
ctttgcgttgcggcgatcttaagcggttgcgcatcgatgacctatccgctcccgaaatgt
gacggctattcgcgccggcccctcaatcgatcgatgtggcagtgggaagacaatagcaac
ttcaagctgaaacagtccgatgcgcgaccggcggcctctcagtccgtcgccaccgcttat
gccggcgagggcagggaatttcccgccttcgcacatctcgacatcgacgcatcctatcgt
ccttgcgagggttga

DBGET integrated database retrieval system