KEGG   Sinorhizobium meliloti 1021: SMa1347Help
Entry
SMa1347           CDS       T00058                                 

Definition
(RefSeq) dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00260  Glycine, serine and threonine metabolism
sme00680  Methane metabolism
sme01100  Metabolic pathways
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01200  Carbon metabolism
sme01230  Biosynthesis of amino acids
Module
sme_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SMa1347
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMa1347
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sme04147]
    SMa1347
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     SMa1347
    1.1.1.399  2-oxoglutarate reductase
     SMa1347
Exosome [BR:sme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMa1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 1235772
NCBI-ProteinID: NP_435982
RhizoBase: SMa1347
UniProt: Q92YX6
Position
pSymA:complement(737144..738118)
Genome map
AA seq 324 aa AA seqDB search
MSFIFSTHRLHPDAEAMLKAASDLRVASAPDPETLLREGEGAEIVIVRAPIPPAFFGNVP
ALRAVVRHGAGLDMIPYDAATAAGVLIANVPAVNAPTVAEHVFMVTLALLRQFRPMDRDL
RNMGWSTGRAHSDRALDLAGRIMGVIGMGNVGKAVFRIAKYGFQLEIVANSRSPESLPDG
VRFLSVDDLLSTADIVVLCCPLTPKTTGLLSRERIARMKPGAILVNVSRGPVVDDAALIE
ALERGRIGGAALDVFSTQPLPPEHPYFRQDNVIVTPHLAGISEESMMRMGKGAAAEAIRV
MEGGLPVNLRNPEVVEHYRRRFPG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcattttctcgacccaccgcctgcaccctgatgccgaagctatgctgaaggca
gcgagtgatctccgcgtcgcgtccgccccggatcccgaaacgttgcttcgtgaaggggag
ggtgcggagattgtcatcgtgcgcgctccgataccgcccgccttcttcggaaatgtaccg
gccctgcgcgccgtagtccggcacggtgcggggctcgacatgattccctatgacgcggcc
acggccgccggtgtgcttatcgccaacgtgccggcggtcaacgcaccgaccgttgcggag
cacgtattcatggtgacgcttgcgttgctgcgacagttccgtcctatggaccgcgacctc
agaaacatgggttggagtactgggcgagcccactccgaccgagcacttgatctcgccggc
cgcatcatgggtgtcatcggcatgggcaatgttggaaaggcggtcttccggatcgcgaag
tacgggttccagctggagatcgttgcgaacagccgctcgcctgaaagcctgccggacggt
gtccggtttctctcagtcgacgacttgttgtcgacggcggatatcgtcgttctttgttgc
ccgctcacgcccaagacgaccgggcttttaagccgcgagcgaattgcgcgcatgaagccg
ggcgcgatcctcgttaacgtgtcgcgcggtccggttgtggacgatgctgccttgatcgag
gcgctagagagggggcgtatcggcggcgctgcccttgacgtgttctctacacagcccctg
ccgcccgagcatccatacttccggcaggacaatgtgattgtgacgcctcatctcgccggc
atcagcgaggaaagcatgatgcgcatgggaaaaggagctgcggccgaagcgatccgggtc
atggaagggggattgcccgttaatctccgcaaccctgaggtcgtcgaacactacaggcgg
cggttccctggatag

DBGET integrated database retrieval system