KEGG   Sinorhizobium meliloti 1021: SMa1487Help
Entry
SMa1487           CDS       T00058                                 

Definition
(RefSeq) cytochrome C
  KO
K08738  cytochrome c
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMa1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 1235845
NCBI-ProteinID: NP_436055
RhizoBase: SMa1487
UniProt: Q92YQ4
Position
pSymA:complement(819484..819852)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAGSVDGFRYSAALKGSGIAWTAETLETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLR
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccggcagcgttgacggcttcaggtattccgcggctcttaaaggttccggtatcgca
tggaccgccgaaacgctggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttagg
gcgcaatag

DBGET integrated database retrieval system