KEGG   Sinorhizobium meliloti 1021: SMa2137Help
Entry
SMa2137           CDS       T00058                                 

Definition
(RefSeq) dehydrogenase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 Se-cys_synth_N Rossmann-like Gp_dh_N F420_oxidored
Motif
Other DBs
NCBI-GeneID: 1236200
NCBI-ProteinID: NP_436410
RhizoBase: SMa2137
UniProt: Q92XS7
Position
pSymA:complement(1207895..1208869)
Genome map
AA seq 324 aa AA seqDB search
MRRDRIVKPKVIVTRRWPTEVEDRLTAEFDTRLNETDQPYDRRELRAALEEADAVLPTVT
DKISADMLEGGIRAKILGNFGVGFNHIDTAAATKVGLVVTNTPGVLTDATADLAMTLLLM
CARRAGEGERELRAGKWTGWRPTHLCGSHVTGKTVGIIGMGRIGQAVARRCHFGFGMDVV
FFDSHSIAGLDVPARQLPSVDDVLATADFVSLHCPGGGENYHLIDDDRLACMKWSAFLIN
TARGDVVDEHALVRALETRRIAGAGLDVFEGEPRVPGRLAERQDVVLLPHLGSATKETRV
AMGMRVIENLKAFFSGRSPPDAVC
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaggagggacaggattgtgaaaccgaaggtcatcgtaactcggcgctggcctacggaa
gttgaagaccggttgactgcggaattcgatacgcggctgaacgaaaccgatcagccttac
gaccggcgcgagttgcgtgccgcgcttgaagaggccgatgcggtcctgccaaccgtaact
gataaaatcagcgccgacatgctcgaggggggtattcgagcaaagatcctcggaaacttc
ggcgttggcttcaatcatatcgataccgcagcggcaacaaaggttggactcgttgtcaca
aatacccctggcgtgctaacggatgcgaccgccgatctagcgatgaccctccttttgatg
tgcgccagacgggcgggggaaggggagagggaactgcgggccggcaaatggacggggtgg
cgtcccacgcatctttgcggatcccatgtcaccggaaagaccgtcggcatcattggaatg
gggcggattgggcaggctgtggcacggcgatgccactttggcttcggtatggacgtcgtt
ttctttgacagccattctattgccggtcttgacgtgcccgcgcgtcaattgccgagcgtt
gacgacgtgcttgcgaccgccgactttgtttcgcttcattgccccggtggaggggaaaac
tatcacctgatcgatgatgatcggctcgcctgcatgaaatggtcagctttccttatcaat
acagccaggggcgacgtcgtggacgaacatgctttggtcagggcgctggaaacccggagg
atagcgggcgcaggtctggacgtcttcgaaggcgagccgcgtgttcccggtcgtctggcc
gagcggcaggacgtggttttgttgccgcatctggggagtgcgacgaaggagacccgcgtc
gccatgggcatgcgcgtcatcgagaatctgaaggcgtttttcagcggccgttcgccgcct
gatgcggtctgctga

DBGET integrated database retrieval system