KEGG   Sinorhizobium meliloti 1021: SMc00103Help
Entry
SMc00103          CDS       T00058                                 

Gene name
dhe
Definition
(RefSeq) alpha-halocarboxylic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00361  Chlorocyclohexane and chlorobenzene degradation
sme00625  Chloroalkane and chloroalkene degradation
sme01100  Metabolic pathways
sme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMc00103 (dhe)
   00361 Chlorocyclohexane and chlorobenzene degradation
    SMc00103 (dhe)
Enzymes [BR:sme01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SMc00103 (dhe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD
Motif
Other DBs
NCBI-GeneID: 1232611
NCBI-ProteinID: NP_385074
RhizoBase: SMc00103
UniProt: Q92RC4
Position
complement(1062702..1063364)
Genome map
AA seq 220 aa AA seqDB search
MSYAAYVFDAYGTLFDVHAAVRRHAEAIGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFW
ELTEQSLDYAFQRFPSADPKLKKPLLDAYWALDCYPEVPAVLKGLKELGARIAILSNGSP
AMLASAVKNAALDIIIDDVFSVDAVKAFKTAPAVYDLVTTSYRLYPQAVSFQSSNRWDIA
GATKFGFRTVWINRADGPDEYKDHGPSLILPSLESLQFGI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgcggcctatgtcttcgacgcctatggcacgcttttcgacgtgcatgcggcc
gtacgccggcacgccgaggcgatcgggccggacggccaggccttttcggaactctggcgc
gccaagcagctcgaatattcctgggtgcgctcgctgatgggcgcctatgtcgacttctgg
gaattgaccgagcaatcgctcgactacgcctttcagcgcttcccctccgccgatcccaag
ctcaaaaagcctcttctcgatgcctattgggcgctcgactgttatccggaagttcccgct
gtcctcaagggattgaaggaactcggcgcccgtatcgccattctttccaacggttcgccg
gccatgttggcctcggccgtcaagaacgccgccctcgatatcatcatcgacgacgttttc
tcggtggatgccgtcaaggcgttcaagacggcaccggctgtctacgatctggtgacgacg
agctaccggctctacccgcaggcggtctcgttccagtcctcgaaccggtgggatatcgcc
ggcgccacgaaattcggttttcgcacggtctggatcaacagagccgacgggccggatgaa
tacaaggaccatggtccttcgctgatcctcccctcgctcgaaagcttgcagttcggcata
tga

DBGET integrated database retrieval system