KEGG   Sinorhizobium meliloti 1021: SMc00262Help
Entry
SMc00262          CDS       T00058                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00071  Fatty acid degradation
sme00072  Synthesis and degradation of ketone bodies
sme00280  Valine, leucine and isoleucine degradation
sme00310  Lysine degradation
sme00362  Benzoate degradation
sme00380  Tryptophan metabolism
sme00620  Pyruvate metabolism
sme00630  Glyoxylate and dicarboxylate metabolism
sme00640  Propanoate metabolism
sme00650  Butanoate metabolism
sme00900  Terpenoid backbone biosynthesis
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01200  Carbon metabolism
sme01212  Fatty acid metabolism
sme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMc00262
   00630 Glyoxylate and dicarboxylate metabolism
    SMc00262
   00640 Propanoate metabolism
    SMc00262
   00650 Butanoate metabolism
    SMc00262
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMc00262
   00072 Synthesis and degradation of ketone bodies
    SMc00262
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMc00262
   00310 Lysine degradation
    SMc00262
   00380 Tryptophan metabolism
    SMc00262
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMc00262
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMc00262
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMc00262
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sme04147]
    SMc00262
Enzymes [BR:sme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMc00262
Exosome [BR:sme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMc00262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt HMG_CoA_synt_N DAO_C
Motif
Other DBs
NCBI-GeneID: 1233350
NCBI-ProteinID: NP_385796
RhizoBase: SMc00262
UniProt: Q92PP6
Position
complement(1830433..1831602)
Genome map
AA seq 389 aa AA seqDB search
MTKAQIVGWAHSQFGKTDHADTEALMAAVAAPALAHAGLAASDVDGIFVGVMNGGFSKQE
FQGALVGMTDEALAHVPSVRLENACATGSAAIYTAMDFIEAGRGRIALVIGAEKMTAVPT
AEVGDILLGGSYRKEEADVEGGFAGVFGRIAQHYFQRYGDRSEELAMIAAKNHANGVANP
YAHMRRDFGFAFCNTVSEKNPIVAAPLRRTDCSLVSDGAAALVLADADTAATLQRAIAFR
ARSHVNDVFALSRRDMLEFDGPRRAWKAALSMAGATLGDLSFVETHDCFTIAEMIEYEAM
GLTAPGEGYRAIRDGTTTRSGSLPVNPSGGLKSKGHPIGATGVSMHVISAMQLMEEAGEM
QIPGAGLAGIFNMGGAAVANYVSILERAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcgcagatcgtaggctgggcccactcccagttcggcaagaccgaccacgcg
gacacagaggcgctgatggccgcggttgcggcgccggcacttgcccatgccggtcttgcc
gcctcggatgtcgacggcatctttgtcggagtcatgaatggcggcttctccaagcaggag
tttcagggcgcacttgtcggcatgaccgacgaggcgctcgctcatgtcccgtccgtgcgc
ctcgaaaacgcctgcgcgacaggctcggcggcgatctataccgcgatggatttcatcgag
gccggccgcggccgcatcgcgctcgtcatcggcgccgaaaaaatgaccgccgttccgacg
gcagaggtcggcgacatccttctgggcggcagctacaggaaagaggaggccgacgtcgaa
ggcggttttgcgggcgtcttcggccgcattgcacagcattacttccagcgttacggcgat
cgttccgaggaacttgcgatgatcgcggccaagaaccacgcgaacggcgtagccaaccct
tacgcgcatatgcgcagggatttcggttttgcgttctgcaacaccgtttccgagaagaat
ccgatcgtcgcggctcccttgcgccgcaccgactgctcgctcgtatcggacggggcggca
gccctcgtgctcgccgacgcggacacggctgcgacgctgcagcgggcaatcgccttccgg
gcccgcagccacgtcaacgacgtgtttgcgctcagccgccgggacatgctggaattcgac
gggccacggcgggcatggaaagcggccctttccatggccggcgccacgctgggcgatctc
tccttcgtcgagacgcatgactgcttcaccatagccgagatgatcgaatacgaggcgatg
ggcctgaccgcacccggcgaaggctaccgtgcgatccgcgacggcaccaccaccagaagc
ggaagcttgccggtcaatccctccggcggcttgaaatcgaagggtcatccgatcggtgcg
acgggggtctcgatgcatgtcatctccgccatgcagcttatggaggaggcgggcgaaatg
cagatccccggcgccggtctcgccggtatcttcaacatgggcggcgctgccgtcgcaaac
tatgtctccatcctggaacgggcgaaatga

DBGET integrated database retrieval system