KEGG   Sinorhizobium meliloti 1021: SMc00340Help
Entry
SMc00340          CDS       T00058                                 

Definition
(RefSeq) oxidoreductase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD F420_oxidored
Motif
Other DBs
NCBI-GeneID: 1231894
NCBI-ProteinID: NP_384366
RhizoBase: SMc00340
UniProt: Q92SV1
Position
complement(296607..297653)
Genome map
AA seq 348 aa AA seqDB search
MPETDRPRTDRPLVISAPAPRTLDLIFTPDALERLHRRYRVIEADPENIAGLGSAVLSEA
RYIVGQPPLSADTLERMPRLRAVLNVESNLIDNMPYDVVFRRGIHVLTTGQVFAEPVAEM
GLAMALNLARGIVDADVDFREGRERWGGEGNKSARLLSGSEIGIIGFGDLGKALNRVLSG
FRAKIRVHDPWLPASVLLDAGVEPASLETVLAESDFLFVVAAVTSDNEGFLGAKAFAAMR
PGAAFILLSRAGVVDFDALIAAVESGHIRAASDVFPEEPLPLGHPVRRLPGFLRSAHRAG
ALDIAFKRMGEMVLEDMELMDRSLPPMRCKRAERETVARMRSKPVTVN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaaccgacaggccgcgaaccgacaggccacttgtcatcagcgcgcccgcgccg
cgtacgctcgatctgatcttcacgcccgacgcgctcgagcgtcttcaccggcgctaccgc
gtgatcgaagccgatccggagaacatcgccgggctcggctccgccgtcctctccgaggcc
cgctatatcgtcggacagccgccgctttccgcggacacgctcgagcgcatgccgcggctg
cgggccgttctcaacgtcgaaagcaatctcatcgacaacatgccctacgacgtggttttc
cggcgcggcatccacgtgctcaccaccggccaggtcttcgccgaaccggtggcggagatg
gggctcgccatggcgctcaacctcgcccgcggcatcgtcgatgcggatgtggatttccga
gaggggcgcgagcgttggggcggtgagggcaacaagtccgcccggctcctctcgggctcg
gagatcggcatcatcggcttcggcgatctcggcaaggcgctcaaccgcgtcctttcggga
tttcgtgcgaagatccgcgtccatgatccctggctgccggcctccgttcttctcgacgcc
ggcgtcgaaccggcgtcgctcgagacggtcctcgccgagagcgacttcctgtttgtcgtc
gcagcggtaaccagcgacaatgagggcttcctcggcgccaaggccttcgcggccatgcgt
ccgggcgccgccttcattctcctgagccgcgccggagtcgtggatttcgatgcattgatc
gcagccgtcgaaagcggccatatccgcgcggcaagcgacgtcttcccggaggagcccctg
cccctcggacatcctgtccgccggctacccggcttcctgcgctcggcgcaccgggccggt
gcgctcgacatcgccttcaagaggatgggcgagatggtgctcgaggatatggaactgatg
gaccgcagcctgccgccgatgcgctgcaagcgggcggagcgggagacggtggcccgaatg
cgctcaaagcccgtcaccgtcaactga

DBGET integrated database retrieval system