KEGG   Sinorhizobium meliloti 1021: SMc00595Help
Entry
SMc00595          CDS       T00058                                 

Gene name
ndk
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00230  Purine metabolism
sme00240  Pyrimidine metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
Module
sme_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sme_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sme_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SMc00595 (ndk)
   00240 Pyrimidine metabolism
    SMc00595 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sme04131]
    SMc00595 (ndk)
Enzymes [BR:sme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SMc00595 (ndk)
Membrane trafficking [BR:sme04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SMc00595 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 1232808
NCBI-ProteinID: NP_385270
RhizoBase: SMc00595
UniProt: Q92QX9
Position
1268126..1268548
Genome map
AA seq 140 aa AA seqDB search
MAIERTFSMIKPDATKRNLTGAITKMLEDAGLRVVASKRVWMSRREAEGFYAVHKERPFF
GELVEFMSSGPTVVQVLEGENAIAKNREVMGATNPANAAEGTIRKVHALSIGENSVHGSD
APETAAEEIAYWFSGTEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaacgtaccttttcgatgatcaagccggatgcgacgaagcgcaatctgacc
ggcgccatcaccaagatgctggaggatgccgggcttcgcgtcgtcgcctcgaagcgcgtc
tggatgagccgccgcgaagccgaaggcttctatgccgtgcacaaggagcgcccgttcttc
ggcgagctcgtcgaattcatgtcctcgggtccgaccgtggttcaggttctcgaaggcgaa
aacgccattgccaagaaccgtgaagtcatgggcgctaccaacccggccaacgctgccgag
ggcacgatccgcaaggtccacgctctttcgatcggcgaaaactcggttcacggttccgat
gccccggaaacggctgccgaggaaatcgcctactggttctccggcaccgagatcgtcggc
taa

DBGET integrated database retrieval system