KEGG   Sinorhizobium meliloti 1021: SMc00827Help
Entry
SMc00827          CDS       T00058                                 

Definition
(RefSeq) transport transmembrane protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SMc00827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 1232413
NCBI-ProteinID: NP_384878
RhizoBase: SMc00827
UniProt: Q92RS7
Position
complement(847602..849146)
Genome map
AA seq 514 aa AA seqDB search
MPLLANITVGEQPLAKPRPRLEKLTLDKDLDKFSLAEEASHHVMRRLAAPGLAALFLILS
MGFAASYFTGASGAAVVVAAAAVAGYMAMNIGANDVTNNVGAAVGAKAISMPVALGIAAV
FEIAGALIAGRKVTLTIEAGIIDGTQLVGAEGLVWVMLSALISSAIWINIATYSRAPVST
THSLIGGIIGAGVAAAGLSSVKWWAIAGITASWTISPVLGGVIAALFLAFLKEFVIYRDD
KISAARRWMPVVLGVTAGSFTAYVAVFAIDHLAFVPLPTGLSIGGLAGIACYIVSKPWIH
RQSEGLENRNQSLRKLFRLPLIFSAALLSFAHGANDVSNAIGPLSAIVSAVDGVISSADS
EAPFWVLLIGALGISVGLLLYGPLLIRVVGEEITRLNPMRAFCVALATAVTVLLASALGL
PISSTHTAVGAVFGVGFFREWYTRHSQRRLEYVRRKTGQTEFMEKGETNFAEVRRRRLVR
RSHFLTIVAAWVITVPVSALLSAFLYLVLSGLFL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctactggcgaatattacagttggagaacagccattggccaagccgcgaccgcgc
ctcgaaaagctgacgctcgacaaggatctcgacaagttcagccttgccgaggaagcgtcg
catcacgtcatgcgcaggttggctgctcccgggcttgccgctctcttcctgatactcagc
atgggcttcgcggcgagctatttcacgggcgcctccggtgcggccgtggtggtggcggct
gcggcggtcgcgggctacatggcgatgaacatcggcgccaacgacgtcaccaacaacgtc
ggagcggcggtcggcgcaaaagcgatatcgatgcccgtggcgctggggattgcggcggtg
ttcgagatcgcgggagcgctgatcgccggccgtaaggtcacgctgaccatcgaggccggg
atcatcgacggcacgcagctggtcggcgccgaagggctggtctgggtgatgctgtcggcg
cttatctcatcggcgatctggatcaatatcgcgacctattcgcgtgcgcccgtttcgacg
acgcattcgctcatcggcggcattatcggcgcaggtgtcgccgccgccgggctttccagc
gtcaagtggtgggcgatcgccggcatcacggcgagctggacgatttcgcccgtgctcggc
ggggtcattgccgcactcttcctcgcctttctcaaggagttcgtcatctaccgcgatgac
aagatctcggccgcccggcgctggatgcctgtcgtcctcggtgtcaccgccggttcgttc
acggcctatgtcgcggtctttgccatcgatcatctggcttttgtcccgcttccgaccggc
ctgtcgataggcgggctggccgggatcgcttgctacatagtgtcgaagccgtggatccac
cgccagtcggaaggtctcgaaaaccgcaaccagtcgcttcgcaagctgttccgcctgccg
ctcatcttctcggccgccctgctgtccttcgcccatggcgcaaacgacgtatcgaacgcg
atcggcccgctgtcggcgatcgtctcggccgtcgacggcgtgatctcgagcgcggattcg
gaggcccccttctgggtactcctcatcggcgcactcggcatctcggtgggtcttctgctc
tacggtccgctgctgatccgtgtcgtcggcgaggagatcacgcgcctcaatccgatgcgc
gccttctgcgtggcgcttgcgaccgccgtgacggttctgcttgcctcggctctcggcctg
ccgatcagttccacccacacggcggtgggcgccgtattcggcgtcggcttctttcgcgag
tggtacacgcgtcactcgcaacggcggctcgaatatgtccggcgcaagacgggccagacc
gaattcatggaaaagggcgagacgaattttgcggaagtgcgtcgccggcgcctggtgcgg
cgctcccacttcctgacgatcgtcgccgcctgggtcatcacggttcccgtgtcggcgctg
ctctcggccttcctctatctcgtcctctccggcctgtttctctag

DBGET integrated database retrieval system