KEGG   Sinorhizobium meliloti 1021: SMc01142Help
Entry
SMc01142          CDS       T00058                                 

Gene name
grpE
Definition
(RefSeq) heat shock protein GrpE
  KO
K03687  molecular chaperone GrpE
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sme03110]
    SMc01142 (grpE)
   03029 Mitochondrial biogenesis [BR:sme03029]
    SMc01142 (grpE)
Chaperones and folding catalysts [BR:sme03110]
 Heat shock proteins
  HSP24
   SMc01142 (grpE)
Mitochondrial biogenesis [BR:sme03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    SMc01142 (grpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GrpE
Motif
Other DBs
NCBI-GeneID: 1232012
NCBI-ProteinID: NP_384484
RhizoBase: SMc01142
UniProt: Q92SK0
Position
408808..409434
Genome map
AA seq 208 aa AA seqDB search
MTDETNKNGPEAAAPEEFETAAEPQAAEKPEADASTTAPDPLELARAESAELRDKYLRLA
AEMDNLRRRTERDVKDAKSYSVAGFARDMLAVSDNLRRALDAIPADAREAGDAGLKALIE
GVEMTERSMLAALERHGVKQLDPTGQKFDPNFHQAMFEVPNTEVPNNTVVQVVQAGYTIG
ERVLRPAMVGVAKGGPKAATSESETPAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaaacgaacaagaacggacccgaggccgcggcgcctgaagaattcgaaaca
gccgctgagccgcaagccgcggaaaagccggaggcggatgcttccacgaccgcgccggat
ccgcttgagcttgccagggccgagagtgcggaactgcgcgacaaatatcttcgccttgct
gcggagatggacaatctgcgccggcgcaccgaacgtgatgtgaaggacgcgaagtcctat
tccgtcgcgggcttcgcgcgcgacatgctggcggtctccgacaacctgcgccgcgcgctg
gatgcgattccggccgacgccagggaggcgggcgatgccggcctgaaagcactcatcgag
ggcgtggaaatgaccgagcggtcgatgcttgcggcgctcgagcgtcacggcgtgaagcag
ctggaccccaccggccagaagttcgatccgaatttccaccaggccatgttcgaggtcccg
aacaccgaggttccgaacaacacggtcgtccaggtggtccaggcaggatacacgatcggc
gagcgcgtcctgcgcccggcgatggtcggcgttgccaagggcggcccgaaagcagccacc
tctgaaagcgagacgcctgctgcttag

DBGET integrated database retrieval system