KEGG   Sinorhizobium meliloti 1021: SMc01350Help
Entry
SMc01350          CDS       T00058                                 

Gene name
gatB
Definition
(RefSeq) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00970  Aminoacyl-tRNA biosynthesis
sme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SMc01350 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sme03029]
    SMc01350 (gatB)
Enzymes [BR:sme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SMc01350 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SMc01350 (gatB)
Mitochondrial biogenesis [BR:sme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SMc01350 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 1232962
NCBI-ProteinID: NP_385420
RhizoBase: SMc01350
UniProt: Q92QK5
Position
1431144..1432694
Genome map
AA seq 516 aa AA seqDB search
MLYRETTNSGFKEEHDMSIVDVRTPDPKRFIPGATGDWEVIIGMEVHAQVLSNSKLFSSA
STEFGSEPNANVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAKINNRSIFDRKNYFYPD
LPQGYQISQYKDPIVGEGKIIISVGPDRQGQFEDVEIGIERLHLEQDAGKSMHDQHPAMS
YVDLNRSGVALMEIVSKPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSV
RRPGEAFGTRCEIKNVNSIRFVGQSIEYEARRQIAILEDGGAIDQETRLFDANKGETRSM
RSKEEAHDYRYFPDPDLLPLEFDDAFVEALKADLPELPDDKKERFVRDLGLSVYDASVLV
SEKAIADYFEAVAEGRDGKAAANWVINDLLGALNKAGKTIEETPVSPAQLGGIIDLIKDG
TISGKLAKDVFEILWNEGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKAK
PSLAGWFVGQVMKATGGKANPQAVQALVKSKLGIEE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
ttgctctaccgagaaaccacgaattcaggcttcaaagaagagcatgacatgagcatcgtc
gacgtccgcactcctgatccgaaacgcttcattccaggcgccaccggcgactgggaggtc
atcatcggcatggaggtccatgcgcaggtgctgagcaattcgaagctgttctccagtgcg
tcgaccgagttcggatcggagccgaatgccaatgtttcgctcgtcgatgccgcaatgccg
ggcatgcttccggtcatcaacgaggaatgcgtcaagcaggccgtgcgcaccggcctgggc
ttgaaggcaaagatcaacaatcgctcgatcttcgaccggaagaactatttctatccggac
ctgccgcagggctaccagatctcgcaatacaaggacccgatcgtcggcgagggcaagatc
atcatttccgtcggtccggaccgccaggggcagttcgaagacgtcgagatcggcatcgag
cgcctgcatctggagcaggatgccggcaagtcgatgcacgaccagcatcccgccatgtcc
tatgtcgacctcaaccggtcgggcgtcgcgctgatggagatcgtctcgaagccggacctg
cgttcgtcggacgaggcgaaagcctatctcaccaagcttcgctcgatcctgcgttatctc
ggcacctgcgacggcaatatggacgagggctcgatgcgcgcggacgtcaacgtctcggtt
cgccgtccgggcgaagctttcggcacgcgctgcgaaatcaagaacgtcaactcgatccgc
ttcgtcggccagtcgatcgagtacgaggcccgtcgccagatcgcgatccttgaagacggc
ggcgcgatcgaccaggagacccggctcttcgatgccaacaagggcgagacccgctccatg
cgttcgaaggaagaggcgcacgactaccgctacttccccgatccggatctcctgccgctc
gagtttgacgatgccttcgtggaagcgctcaaggccgaccttcccgaattgccggacgac
aagaaggaacgcttcgttcgcgatctcggcctgtccgtttacgatgcgtccgttctcgtc
tcggaaaaggcgattgccgattacttcgaagccgtggccgaaggccgtgacggcaaggcg
gcggcgaactgggtgatcaacgatcttctcggcgcgctgaacaaggccggcaagaccatc
gaggaaacgccggtctcgccggcgcagctcggcggcatcatcgatctcatcaaggatggc
accatttccggcaagctcgcaaaggacgtcttcgaaatcctttggaacgagggaggcgat
ccggccgaaatcgtcgagagccgcggtatgaagcaggtcaccgacaccggtgcgatcgag
aaggcggtcgacgagatcatcgccgccaatcccgaccaggtggaaaaggccaaggcgaag
ccgtcgctcgccggctggttcgtcgggcaggtgatgaaggcgaccggcggcaaggccaat
ccgcaggcggtgcaggccctggtaaaatccaaactcggcatcgaggagtga

DBGET integrated database retrieval system