KEGG   Sinorhizobium meliloti 1021: SMc01943Help
Entry
SMc01943          CDS       T00058                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN Gp_dh_N F420_oxidored Sacchrp_dh_NADP AdoHcyase_NAD GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 1234145
NCBI-ProteinID: NP_386583
RhizoBase: SMc01943
UniProt: Q92MX8
Position
complement(2665350..2666327)
Genome map
AA seq 325 aa AA seqDB search
MMTAKPRILITRRWPQAVERVLAERFDTVLNEEDRPLDRSALADALRNFDAVLPTVSDRL
PADVFTGGGLRTRILGNFGVGYNHIDAGAAKEAGIVVTNTPGVLTDCTADLAVSLLLAAA
RRTGEGERQVRAGAWDGWRPTHMIGTKVTGKTLGIIGFGRIGKAMAKRCHFGFDMDIVFY
NRSRVAPEEAARFGARQLDTVEDVLRAADFVSLHCPGGGENRHLINAARLAAMKPAAYLI
NTSRGDVVDEAALIAALEKGVIRGAGLDVYEAEPDVPTRLRALENVVLLPHLGSATEETR
TAMGMKVVDNITAFFAGLQPPDRVA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgccaagccgcgcattcttatcactcgccgctggccgcaggccgtggagcgg
gttttggccgaaaggttcgatacagtcctcaacgaggaggaccggccgctcgacaggagc
gcgctcgcagacgccttgcgtaatttcgatgcggtgctgccgaccgtctcggaccggctg
ccggccgatgttttcacgggcggaggtcttcgcacccggatcctcggcaatttcggcgta
ggctacaatcacatcgacgccggagctgccaaggaagccggcatcgtggtgacgaatacg
cccggcgttctgaccgattgcactgctgatctcgccgtatcgctgctgctcgccgccgcg
cgccggaccggcgaaggcgagcggcaggtgagggcgggcgcgtgggacgggtggcggccg
acccacatgatcggaacgaaggtgacgggcaagacgctcggcatcatcggcttcgggcgc
atcggaaaagccatggcgaagcgctgccatttcggcttcgacatggacatcgtcttctac
aaccgctccagggtagcgccggaggaagcggcgcgcttcggggcccgccagctcgatacg
gtcgaggacgtgctcagggcagcggacttcgtgtcgctgcattgcccgggcggcggcgag
aaccggcatttgatcaacgcggcgcgccttgcggcaatgaagccggccgcctatctcatc
aacacgtcgcggggcgatgtcgtggacgaggcggcattgatcgcggcccttgagaagggc
gtgatccgcggcgccgggctcgatgtctacgaggcggagcctgacgttcccacgcgcctg
cgtgcgctcgaaaacgtcgtgctgctgccgcatctcggcagtgccacggaggagacgcgc
acggcaatggggatgaaggtcgtcgacaacatcacggcgttcttcgcgggcctgcagccg
ccggaccgggtggcgtga

DBGET integrated database retrieval system