KEGG   Sinorhizobium meliloti 1021: SMc02082
Entry
SMc02082          CDS       T00058                                 

Symbol
tolC
Name
(GenBank) Putative outer membrane secretion protein
  KO
K12340  outer membrane protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme01501  beta-Lactam resistance
sme01503  Cationic antimicrobial peptide (CAMP) resistance
sme02020  Two-component system
sme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMc02082 (tolC)
  09132 Signal transduction
   02020 Two-component system
    SMc02082 (tolC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SMc02082 (tolC)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SMc02082 (tolC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SMc02082 (tolC)
   02044 Secretion system [BR:sme02044]
    SMc02082 (tolC)
   01504 Antimicrobial resistance genes [BR:sme01504]
    SMc02082 (tolC)
Transporters [BR:sme02000]
 Other transporters
  Pores ion channels [TC:1]
   SMc02082 (tolC)
Secretion system [BR:sme02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   SMc02082 (tolC)
  RTX toxin transporter
   SMc02082 (tolC)
  Multiple protein transporter
   SMc02082 (tolC)
  RaxAB-RaxC type I secretion system protein
   SMc02082 (tolC)
Antimicrobial resistance genes [BR:sme01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    SMc02082 (tolC)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    SMc02082 (tolC)
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: CAC46093
RhizoBase: SMc02082
UniProt: Q92Q38
Position
1629672..1631042
AA seq 456 aa
MVSIVRKAALWAAVSTSVLLAPHAVLAETIFGAMAKAYANNPDLNAARAGLRATDEGVPI
AKAGYRPQISASATGTLSRVDAERTGTRDFHSGQVGISITQTIFDGFQTLNNVRAAQADV
FSSRETLKANEIQILLSAAQSYANIARDQQVVSIRRQNLAFLREQLSAAQARLEVGEGTR
TDVSQAEAELANAQSLLVAAIAQLKQSEAVYVQIVGAAPTGIRQPGPATKAMPRSLDQAV
ATGLRENPQILAAQYAVDSAGYQVKSAEGTMLPGVVLQGAVSRNTGNAGQGLDDTTASVT
ARLEVPIYQGGAEYGQIRQAKEILGQQRILVDSARASVQQTVVSAHAQLESALARIRASR
SQIAAANLALEGVVEERKVGQRTTLDVLISQQDVLDAQEALAGAQRDAVVASYALLAAMG
HLTVRSQGLQVAEYRAEEHYEAVKDKWFGLRTVDGR
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggtgtcgattgtccgcaaagcagccttgtgggcggctgtctcgaccagtgtgctgctc
gcgccccacgccgttctcgcggagacgattttcggggcaatggccaaggcctatgcgaac
aacccggatctcaacgccgctcgcgccggcctgcgcgcgaccgacgaaggggtgccgatt
gcgaaggccggctaccggccgcagatttccgcgtccgccacggggacgctctcacgggtc
gacgccgaacggaccggcacccgcgactttcattccggacaggtcgggatttccatcacg
cagacgatcttcgatggatttcagacattgaacaatgtcagggcggcccaagcggacgtg
ttttcgagccgcgagacgctgaaagccaatgagattcagatccttctttcggccgcgcag
tcctatgcgaacatagcccgcgatcagcaggtcgtttccattcgccggcagaacctggcc
ttccttcgggaacagttgagcgccgcccaggcccgcctcgaagtgggcgaaggcacgcgg
acggatgtgagccaggcggaagccgaactcgccaacgcacagtcgctgctcgtcgctgca
atcgcgcagctgaagcagagcgaagcggtctatgtccagatcgtcggcgcagcgccgacc
ggcatcagacagcccggaccggccacgaaggccatgccaaggtctctcgaccaggccgtt
gcgacggggctgcgggagaacccgcagatcctggcggcgcaatatgccgtcgattcggcc
ggttaccaggtgaaatcggcggaaggcacgatgctgccgggcgtcgttctccagggcgcc
gtgagccgtaacaccggtaatgccggtcaggggcttgatgacacgacggccagcgtcacg
gctcggctcgaagttccgatctatcagggcggtgcggaatacggccagattcgccaggcg
aaggaaatcctggggcagcagcgaatcctcgtcgactcggcgcgggcctcggtgcagcag
accgtggtttcggcccatgcgcagctcgagtccgcactcgccagaatcagggccagccgg
tcgcagatcgccgccgccaatctcgcgctcgaaggcgttgtcgaagaacgcaaggtcggc
cagcgcacgactctcgacgttctcatttcgcagcaggacgttctcgacgcgcaggaggca
ttggccggagcgcagcgcgacgccgtggttgcaagctacgccttgctcgccgcaatgggc
cacctgacagtcaggagccagggcctgcaggtggccgaataccgggccgaggaacattac
gaggccgtcaaggacaagtggttcggcctgcgcaccgtcgacgggcgctaa

DBGET integrated database retrieval system