KEGG   Sinorhizobium meliloti 1021: SMc02140Help
Entry
SMc02140          CDS       T00058                                 

Gene name
phoB
Definition
(RefSeq) phosphate regulon transcriptional regulatory protein
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02020  Two-component system
Module
sme_M00434  PhoR-PhoB (phosphate starvation response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMc02140 (phoB)
Two-component system [BR:sme02022]
 OmpR family
  PhoR-PhoB (phosphate) [MD:M00434]
   SMc02140 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-GeneID: 1232151
NCBI-ProteinID: NP_384621
RhizoBase: SMc02140
UniProt: Q52990
Position
572383..573066
Genome map
AA seq 227 aa AA seqDB search
MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERLPDLLILDWMLPGVS
GIELCRRLRQRPETERLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAML
RRAKPEVLSTLLRCGDIELDRETHRVHRRSREVRLGPTEFRLLEFLMSSPGRVFSRSQLL
DGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTVRGAGYSLES
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgaagattgccgtagtcgaagatgaggaagccctaagcgttctcctgcgctac
aatctcgaggcagaaggcttcgaggtcgatacgatccttcgcggcgacgaggcggagatc
cgcctgcaggagcgcctgcccgaccttctcatcctcgattggatgctgcccggggtttcc
ggcatcgagctctgccgcaggctgcgccagcggccggaaacggagcgcctgccgatcatc
atgctgacggcgcgcggcgaggagagcgagcgcgtgcggggccttgccaccggggccgac
gattacgtcgtcaagcccttctcgacgccggaactgatggcgagggtcaaggctatgctc
aggcgcgccaagcccgaggttctgtcgacgctcctgcgctgcggcgatatcgagctcgac
cgggagacgcaccgcgtccaccgccgcagccgtgaagtgcgcctcggcccgacggagttc
cggctgctggaatttctcatgtcctcaccggggcgcgtcttctcccgttcacagctcctg
gacggtgtctgggggcacgacatctatgtcgacgaacggaccgtggacgtccatgtcgga
cgtctgcgcaaggcactgaacttctccaacatgcccgacgtcatccggacggtgcgcggc
gcgggctattcgctggagagctga

DBGET integrated database retrieval system