KEGG   Sinorhizobium meliloti 1021: SMc02227Help
Entry
SMc02227          CDS       T00058                                 

Gene name
fadB
Definition
(RefSeq) fatty oxidation complex enoyl-COA hydratase/3-hydroxyacyl-COA dehydrogenase/3-hydroxybutyryl-COA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00071  Fatty acid degradation
sme00280  Valine, leucine and isoleucine degradation
sme00281  Geraniol degradation
sme00310  Lysine degradation
sme00362  Benzoate degradation
sme00380  Tryptophan metabolism
sme00410  beta-Alanine metabolism
sme00640  Propanoate metabolism
sme00650  Butanoate metabolism
sme00903  Limonene and pinene degradation
sme00930  Caprolactam degradation
sme01040  Biosynthesis of unsaturated fatty acids
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01200  Carbon metabolism
sme01212  Fatty acid metabolism
Module
sme_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SMc02227 (fadB)
   00650 Butanoate metabolism
    SMc02227 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SMc02227 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SMc02227 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMc02227 (fadB)
   00310 Lysine degradation
    SMc02227 (fadB)
   00380 Tryptophan metabolism
    SMc02227 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMc02227 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMc02227 (fadB)
   00281 Geraniol degradation
    SMc02227 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMc02227 (fadB)
   00930 Caprolactam degradation
    SMc02227 (fadB)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SMc02227 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMc02227 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SMc02227 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C FAD_binding_3 NAD_binding_8 ApbA Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 1232169
NCBI-ProteinID: NP_384638
RhizoBase: SMc02227
UniProt: Q92S88
Position
complement(587900..590113)
Genome map
AA seq 737 aa AA seqDB search
MSYTNFKIETDADGIALVTWDMPDKSMNVFTEEVMKELDAIIDQTTADPAVKGVVITSGK
SSFSGGADLSMIKSMFTFQAEERKKDPDNAARKLFDLVGRMTGLFRKLETSGKPWVSAIN
GTCMGGAFEMSLACHGRVASNAKSVKIALPEVKVGIFPGAGGTQRVPRLTNTQDALQMMT
TGSSLTPARAKAMGLVHEVVDPDKLIEAAKAMIKNGLKPVQPWDEKGFKLPGGGIWTPAS
AQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTALKIEQRYFTEILQTTEAFSM
IRSLFVSMQELGKGARRPAGVPKTELKKVGVVGAGFMGASIAYVTAAGGIPVTLIDRDME
AAEKGKTHSEGLVKDAIGKGRLTKEEGEALLSRITPSADYGDLRDAGLVIEAVFEDRQVK
KDVIEKVEAVIAEDAIFASNTSTLPITGLARNSKRPDRFIGIHFFSPVEKMMLTEVILGK
ETGDRALAAALDYVAAIRKTPIVVNDTRGFYVNRCVFRYIHEAYDMLIEGVPPAMIENAA
KMAGMPVGPLSLNDEVAIDLSQKILKAAVADLGDKAVDLRHMALIDKMVDELDRRGRKNG
KGFYEYPAKPARKYLWPGLKELYPQKDAGEIEVGVLKQRLLVTIALEAARTIEEGIVTDP
READVGSILGFGFAPYTGGTLSYIDGMGAKAFVELCEKLAADHGDHFRPTPLLKEMAEKG
ETFYGRFDPYGAGQKAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacacgaacttcaagatcgaaaccgacgccgacggcattgcgctggtcacctgg
gacatgcccgacaagtcgatgaacgtcttcaccgaagaggtgatgaaggaactcgacgcc
attatcgatcagacgaccgcagatcctgccgtcaagggcgtggtcatcacctccggcaaa
tcctccttctccgggggtgccgacctttcgatgatcaagtcgatgttcaccttccaggcc
gaggaaaggaagaaggacccggacaacgcggcccggaaactcttcgacctcgtgggccgg
atgacgggtctcttccgcaagctcgaaacctcgggcaagccctgggtgtcggccatcaac
ggcacctgcatgggcggcgccttcgagatgtcgctcgcctgccacggccgtgtcgcctcc
aatgcgaaatcggtgaagatcgcgcttcccgaggtcaaggtcggcattttcccgggcgcc
ggcggcacccagcgcgttccgcggctgaccaatacgcaggacgcgctgcagatgatgacg
accggctcctcgctcacgccggcgcgggcaaaggccatggggctcgtccacgaggtggtc
gatccggacaagctgatcgaggctgccaaggcgatgatcaagaacggcctgaagccggtt
cagccctgggacgagaagggcttcaagctgccgggcggcggcatctggacgcccgcctcc
gcgcagctctggccggccgcctccggcatcctgcgccgcgagacctacggcaattacccc
ggcgcgatcgcgatcctgaaatgcgtctatgaggggctgcaggttcccttcgatacggct
ttgaagatcgagcagcgctatttcaccgaaatcctgcagacgaccgaagccttctcgatg
atccggtcgctgttcgtctcgatgcaggaactcggtaagggcgcgcgccggccggccggt
gtaccgaagaccgagctcaagaaagtcggcgtcgtcggcgccggtttcatgggcgcctcg
atcgcctatgtaaccgcggcgggcggcatccccgtcaccctcatcgaccgcgacatggaa
gctgccgaaaagggcaagacgcattcggaaggcctggtcaaggacgcgatcggtaaggga
cgcttgaccaaggaggaaggcgaagcgctgctttcgcgcatcacaccttcggcggactat
ggcgatctcagggatgccggcctcgtcatcgaggcggtcttcgaggaccggcaggtcaag
aaggacgtgatcgagaaggtcgaagcggtgatcgccgaggacgcgatcttcgcctccaac
acctcgacgctgccgatcaccggcctcgccaggaattccaaacgcccggaccggttcatc
ggcattcatttcttctcgccggtcgagaaaatgatgctgaccgaggtgatcctcggcaag
gagaccggagaccgtgcgctcgcggccgcgctcgactatgtcgcggcgatcaggaagacg
ccgatcgtcgtcaacgacacgcgcggcttctacgtcaatcgctgcgtcttccgctatatc
cacgaagcctatgacatgctgatcgagggcgtaccgccggcgatgatcgagaacgccgcc
aagatggccggcatgccggtcggaccgctgtcgctcaacgacgaggtggcgatcgacctc
agccagaagatcctgaaggcggccgttgccgatctcggcgacaaggccgtcgatctcagg
cacatggcgctgatcgacaagatggtcgacgagctcgaccggcgcggccgcaagaacggc
aagggtttctacgagtatccggcaaagccggccaggaaatatctctggccgggcctgaag
gagctctacccgcagaaggatgccggcgagatcgaggtcggtgtgctcaagcagcgcctg
ctcgtgacgatcgcactcgaagccgcgcgtacgatcgaggagggcatcgtcaccgacccg
cgcgaagccgatgtcggctcgatcctcggcttcggctttgcgccctacaccggcggcacg
ctctcctacatcgacggcatgggtgcgaaagccttcgtcgagctttgcgaaaagctcgcc
gcggaccatggcgaccacttccggccgacgccgcttttgaaggagatggcggaaaagggc
gaaaccttctacgggcgcttcgacccgtatggcgcggggcagaaggcggcataa

DBGET integrated database retrieval system