KEGG   Sinorhizobium meliloti 1021: SMc02442Help
Entry
SMc02442          CDS       T00058                                 

Definition
(RefSeq) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMc02442
Enzymes [BR:sme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     SMc02442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Resolvase
Motif
Other DBs
NCBI-GeneID: 1234291
NCBI-ProteinID: NP_386723
RhizoBase: SMc02442
UniProt: Q92MJ9
Position
complement(2826115..2826972)
Genome map
AA seq 285 aa AA seqDB search
MTFKAAAVQICSGVDPAGNAETMAKLVREAASRGATYVQTPEMTGAVQRDRTGLRSVLKD
GENDVVVREASRLARELGIYLHVGSTPIARADGKIANRGFLFGPDGAKICDYDKIHMFDV
DLENGESWRESAAYHPGNTARTADLPFGKLGFSICYDVRFPELFRQQAVAGAEIMSVPAA
FTRQTGEAHWEILLRARAIENGLFVIAAAQAGTHEDGRETFGHSMIVDPWGRVLAEAGAT
GEEIIVAEIDVAAVHAARAKIPNLRNARSFVLDEVVPVGKGGAAA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcaaggctgccgccgtccagatttgctccggtgtcgaccccgcaggaaatgcg
gagacgatggcgaagctggtgcgcgaagcggcttcgcggggcgcaacctatgttcagacg
ccggagatgaccggagcggtccagcgcgaccggacgggtttgcggtcggtgttgaaggat
ggggagaacgacgtcgtcgttcgcgaggcatcccggcttgcccgcgagctcggaatttac
ctgcatgtcggctcgacaccgatcgcgcgcgcggatggaaagattgccaatcgcggcttc
ctgttcgggcctgacggcgcgaagatctgtgattacgacaagatccacatgttcgacgtg
gatctggagaatggcgaaagctggcgcgagagcgccgcctatcatccgggtaataccgcc
cgtactgccgatcttcccttcggcaagctcggtttttcgatctgctacgatgtgcgcttc
cccgagcttttccgccagcaggccgtggcgggagccgagatcatgtcggtgccggcggcg
ttcacgcgccagaccggcgaggcgcattgggaaatcctgctgcgcgcccgggccatcgaa
aacgggctcttcgttattgccgccgcccaagcgggcacgcatgaggatggccgggagacc
ttcggccactcgatgatcgtcgatccctggggcagggtgctggccgaagccggagcgacc
ggcgaggagatcatcgtcgccgagatcgatgtggcggcggtgcacgcggcgcgcgccaag
attcccaacctcaggaacgcgcgcagcttcgtgttggatgaggtggttccggtgggaaaa
ggaggcgctgcagcttga

DBGET integrated database retrieval system