KEGG   Sinorhizobium meliloti 1021: SMc02604Help
Entry
SMc02604          CDS       T00058                                 

Gene name
folD1
Definition
(RefSeq) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00670  One carbon pool by folate
sme01100  Metabolic pathways
sme01120  Microbial metabolism in diverse environments
sme01200  Carbon metabolism
Module
sme_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SMc02604 (folD1)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SMc02604 (folD1)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SMc02604 (folD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Pcc1 Mastoparan_2
Motif
Other DBs
NCBI-GeneID: 1231712
NCBI-ProteinID: NP_384187
RhizoBase: SMc02604
UniProt: Q92T88
Position
complement(96439..97359)
Genome map
AA seq 306 aa AA seqDB search
MTTIIDGKAVAASINGAIKDANAELQEQTGRKTGLSVIIVGDDPASHAYVGAKSRMAKEC
GFFSVQHTLPKETTQQELAGLVHQLNADDGIHGILVQLPLPEHLDADAIIQSIRPEKDVD
GLHVANAGKLATGDLESGLISCTPAGAMVFVRRVHGRDLSGLNALVIGRSNLFGKPMAQL
LLNANATVTIAHSRTSDLASICRNADIVIAAVGRPEMVKANWLKTGATVIDVGINRVPAP
EKGENRTRLVGDVAFAECAPFASAITPVPGGVGPMTIAMLMANSVIAAHRASGLKVSERL
SKLISG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatcatcgacggcaaggccgtagcggcttccatcaacggcgcgataaaagac
gcaaatgccgagctgcaggagcagacaggcaggaaaaccggactttccgtcattatcgtc
ggcgacgatcccgcaagtcatgcctatgtcggcgcaaaaagccgcatggccaaggagtgc
ggcttcttttcggtccagcacacgctgccgaaggaaacgacacagcaggagcttgcgggc
ctggtgcatcaactgaacgctgatgacggcatccatggaattctcgtgcagctgcctttg
ccggagcacctggacgcagatgccatcattcagtcgatccggcccgaaaaggacgtcgac
ggcctgcatgttgccaatgccggaaagctcgcaaccggcgacctggagagcggcctgatc
tcctgcaccccggcaggcgcgatggtctttgtgcgccgcgtgcacggccgcgacctttcc
ggcctgaatgcgctggtcatcggtcgttccaatctcttcggcaaaccgatggcgcagctg
ctgctgaatgccaatgcgacggtgacgatcgcccattcccgcaccagcgatctggcctcg
atctgccgcaacgccgatatcgtgatcgccgccgtcggccggcccgaaatggtcaaggcg
aactggttgaagacgggcgccaccgtcatcgatgtcgggatcaaccgtgttcccgcacct
gagaagggggagaacaggacgaggctggtcggcgacgtcgctttcgcggagtgcgcacca
ttcgcatcggctattacgccggttccgggcggcgtcggaccgatgaccatcgccatgttg
atggccaacagcgtgattgcagctcacagagcatccggcctgaaggtgtccgaacggctc
tcgaagctgatatccggctga

DBGET integrated database retrieval system