KEGG   Sinorhizobium meliloti 1021: SMc02726
Entry
SMc02726          CDS       T00058                                 
Symbol
bhuR
Name
(GenBank) Hemin-binding membrane protein
  KO
K16087  hemoglobin/transferrin/lactoferrin receptor protein
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SMc02726 (bhuR)
Transporters [BR:sme02000]
 Other transporters
  Pores ion channels [TC:1]
   SMc02726 (bhuR)
SSDB
Motif
Pfam: TonB_dep_Rec Plug OMP_b-brl_3
Other DBs
NCBI-ProteinID: CAC46967
RhizoBase: SMc02726
UniProt: Q92N43
Position
complement(2576060..2578291)
AA seq 743 aa
MLNRHHRLALLACTAAIFALPIPPVLAQSAPTETAAEGNANTTVLKKIVAKGDRLAGAQR
GGIADTPLATEIDAKTLEEKQVTDLDDLGRSVDAGINASRADFGINLRGLSGPRIVTTID
GVPIPYISNSARQGAFASINANGGGDMFDFNSLSVVDIVRGADSSRGGSGMLGGAVVLRT
LEPEDVISDGKDWGAIFRSIYDSEDDSIAGSVAGAHRFGQTSVLFQGSYRKGNERDNEGT
VGGYGSARTEPNPTDFDQNNLLFKFRHELEGGHRIGLTAESFRRDADNDLRAEQGRRYKI
GDYTGFEDRDRKRVSLDYDFEAASSDDFFSFARASLYWQDLERSSGSNGRTIADVPYGRD
NSISNESVGFNGRAGKDFETGGFDHSLTFGLDVARSEWSQYTSAVCPTPATCPALNNQSE
VPDVRSMTVGAILEDRISVGDSAFALTPGLRFDWFQYDPQLNAGFESNTGSGIFGDLKAR
DGVRLSPKLLATYDVTPDVELFAQWSMAFRAPTVDELYSRFYNPFGNYAQLGNPDLKPET
GKGFEIGANFDTGELSGRVAAFHNIYDNFIETGDSINSDTGIREFKYANVNKARISGIEL
SALKTFDNGFNLHASLAYSYGKNEDEGTRLRTVAPFKAIIGGGYSQETFGVDVSTTVSAA
MPDDNDSETFDAPGYGLVDMTGWWTPESFKGLRVEAGVYNIFDKKYFNALGVRGVDLASS
SAQPRDFYSEPGRTFKVSLTQRF
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgctcaaccggcatcatcgcctggcgcttttggcttgcacggcagcaatattcgcgctc
ccgatccccccggttctggcgcagagcgcgccaaccgaaacggcggcggaaggaaatgcc
aacacgaccgtgctgaagaagatcgtcgcgaaaggcgaccgcctggcaggtgcgcagcgt
ggcggcatcgcggatacgccgcttgcgaccgagatcgacgcaaagaccctggaggagaag
caggtcacggatctcgacgatctcggccgcagcgtcgacgcagggataaatgcatcgcgt
gccgacttcggtatcaatcttcgcggtctttccggtcctcgtatcgtgaccacgatcgac
ggcgttccgatcccctatatctcgaacagcgcccgtcagggtgcctttgcctcgatcaat
gcgaacggcggcggggacatgttcgatttcaattcgctctccgtggtcgacatagtgcgc
ggggcggattcgagccgtggcggttccggcatgctcgggggcgccgtggtgctgcgcacg
ctcgagcccgaggatgtcatatccgacggaaaggattggggcgcgatcttcaggtccatc
tatgacagcgaagacgacagcattgcgggctcggttgctggagcccacagattcggccag
acctccgttctctttcagggcagctaccgcaaggggaatgaacgggataacgaggggacg
gtcggtggctacggatccgcccgcacggagcccaaccctaccgatttcgaccagaacaac
ttgctcttcaagtttcggcatgaactcgaaggcggtcacagaatcggcctgacggcggaa
agcttccgccgcgacgccgacaatgatctcagagcggaacaggggcgccggtacaagatc
ggcgactataccggttttgaagaccgcgaccgcaagcgcgtctcgctggactatgatttc
gaggccgcctcgtcggacgacttcttcagcttcgccagggcatcgctctactggcaggat
ctggaacgctcctccggctcgaatggccggacgatcgccgatgtgccctacgggcgcgac
aattcgatcagcaacgagagcgtgggtttcaacggacgcgcaggcaaggatttcgaaacc
ggcggtttcgatcattcgctaaccttcggcctcgatgtcgcccgttccgagtggagccag
tatacctcggcggtttgcccgacgccggcgacatgcccggcgctcaacaaccagtccgaa
gtccccgacgtgaggagcatgacggtcggcgccatattggaagaccgcatttcggtcggc
gacagcgcgtttgcgctcacgccggggttgcgcttcgactggttccaatatgaccctcag
ctcaatgcaggcttcgagtcgaatacaggatcgggaatcttcggggatctgaaggccagg
gatggggttcgcctgtcgccgaagctcctcgcgacctatgacgttacgccggatgtcgag
ctgttcgcacaatggtcgatggccttccgggcgccgaccgtggacgagctttatagccgc
ttctacaacccgttcggaaactatgcccagctcggcaatccggatctcaagccggaaacc
ggcaaaggattcgagatcggtgccaatttcgacaccggtgagctgagcggccgggtcgcg
gcgttccacaatatctatgacaatttcattgaaaccggcgattccatcaacagcgacacc
gggatcagggaattcaaatatgccaacgtcaacaaggcccgaatctcgggtatcgagttg
agcgcgttgaaaaccttcgacaacggcttcaacctccatgcgtcgcttgcctactcctat
ggcaagaacgaggacgagggcacgcggctgcggacggtcgcgccattcaaggcgatcatc
ggcggcggctacagccaggaaaccttcggtgtcgatgtctcgacgacggtctcggcagcc
atgccggacgataacgacagcgaaaccttcgatgcccccggctacggtctcgtggatatg
accgggtggtggacgcccgaaagcttcaagggattgagggtagaggccggggtctataac
atcttcgacaagaagtatttcaacgcgctcggcgtacgtggcgtcgacctcgcctcatcg
tccgctcagccgcgcgacttctattccgaaccgggacgcacgttcaaagtctcgttgacg
caacgcttctga

DBGET integrated database retrieval system