KEGG   Sinorhizobium meliloti 1021: SMc02765Help
Entry
SMc02765          CDS       T00058                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00260  Glycine, serine and threonine metabolism
sme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01130  Biosynthesis of antibiotics
sme01230  Biosynthesis of amino acids
Module
sme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMc02765 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMc02765 (trpA)
Enzymes [BR:sme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMc02765 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-GeneID: 1231654
NCBI-ProteinID: NP_384135
RhizoBase: SMc02765
UniProt: Q92TC8
Position
29274..30113
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFDTSLAIMKALRQAGADIIELGVPFSDPMA
DGPAIQLAGQRALKAGQSLAKTLELARLFRAEDQRTPIVLMGYYNPIYIYGVERFLADAL
EAGVDGLIVVDLPPEMDDELCIPALEKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSLIAGAVARIKAHTPLPVCVGFGVKTADHARAIGASADGVVVGTAIVNQ
IASSLTEEGRATEATVPGVEALVRGLAAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggagcaacggttcgccgacgtggcggccgaggggcgcccggtcctc
gtgacctatttcatgggcggcgacccggatttcgacacgtcgctggcgatcatgaaggcg
ctgcggcaggcgggtgccgacatcatcgaactcggcgtgcccttttccgacccgatggcc
gatggaccggcgatccagctcgccggccagcgcgcgctgaaggcggggcagtctctcgcc
aagacgctggagctcgcccggctcttccgggcggaggaccagcgcacccccatcgtgctg
atgggctattacaacccgatctatatctatggcgtcgagcggttcctggcggacgcactc
gaggccggcgtcgacggcctgatcgtcgtcgatctgcccccggaaatggacgacgaactc
tgcattccggcacttgagaagggcatcagcttcatccgcctggcaacgcccacgacggac
gatcgccgcctgcccaaggttctcgaaaacacgtcgggtttcgtgtattacgtctcgatg
accgggatcaccggctcggcgctgcccgatccgtcgctgatcgccggagcggtcgcgcgc
atcaaggcgcatacgcccttgcctgtctgcgtcggcttcggggtgaagaccgccgaccat
gcgcgcgccatcggcgcatccgcagacggcgtcgtcgtcggcacggcgatcgtcaatcag
atcgcgtcgagcttgaccgaagaaggccgggcaacggaagcgacggtcccgggtgtcgaa
gcgctcgtcagggggcttgcggccggcgtacgggcggcacggcttgctgcagccgaataa

DBGET integrated database retrieval system