KEGG   Sinorhizobium meliloti 1021: SMc02849Help
Entry
SMc02849          CDS       T00058                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00630  Glyoxylate and dicarboxylate metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SMc02849
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     SMc02849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AlaDh_PNT_C GFO_IDH_MocA IlvN F420_oxidored Shikimate_DH Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 1231805
NCBI-ProteinID: NP_384280
RhizoBase: SMc02849
UniProt: Q92T15
Position
197325..198329
Genome map
AA seq 334 aa AA seqDB search
MTSKKKPTVYITRKLPDVVETRMRELFDAELNIDDTPRSQPELVAAVKRADVLVPTVTDR
IDAALIEQAGPQLKLIAAFSNGVDNIDVDAAARKGITVTNTPNVLTEDTADMTMALILAV
PRRLAEGAQVLTDRKGEWAGWSPTWMLGRRIAGKRIGIVGMGRIGTAVARRAKAFGLSIH
YHNRHRVKPETEEMLEATYWDSLDQMLARVDIVSVNCPSTPATYHLLSARRLALMRPDSY
IVNTARGGIIDEAALIKSLREGKIAGAGLDVFENEPCVNPKLIKLAGEGKVVLLPHMSSA
TLEGRIDMGEKVVINIRTFFDGHRPPDRVLPGRD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaagaaaaagccaacggtctacatcacccgcaaactgccggatgtcgtcgaa
accaggatgcgtgagctcttcgacgcggagctgaacatcgatgacacgccgcgcagccag
ccggagctggtcgccgcggtcaagcgggccgacgtgctcgtgccgacggtgacggaccgg
atcgatgcggcgctgatcgagcaggccgggccgcagctgaagctgattgccgccttctcg
aacggcgtcgacaacatcgatgtggatgcggccgcacgcaagggcataaccgtcaccaac
acgccgaacgtcctgaccgaggacacggccgacatgaccatggcgctgatcctcgcggtg
ccgcgccggctcgccgaaggtgcgcaggtgctgaccgaccgcaagggggagtgggcaggc
tggtctcccacctggatgctgggccggcgcattgccggcaaacgcataggcatcgtcggc
atggggagaatcggcaccgccgtcgcccgccgtgccaaggccttcgggctttcgatccac
tatcacaatcgccaccgcgtcaaaccggaaaccgaggagatgctggaagcgacctattgg
gacagcctcgaccagatgcttgcccgcgtcgacatcgtctccgtcaactgcccgtcgact
ccggcgacctatcatctgctctcggcccggcggctggcgctgatgcggcccgacagctac
atcgtcaacaccgcgcgcggcggcatcatcgatgaggcggcgctgatcaagagcctccgc
gagggcaagatcgccggcgccgggctcgacgtcttcgagaacgagccgtgcgtcaatccg
aagctcatcaaacttgccggcgagggaaaggtcgtgctcctgccgcatatgagttccgcg
acgctcgaaggccgtatcgacatgggcgagaaggtggtgatcaacatccgcaccttcttc
gacggccatcgcccgccggacagggtcctgccggggcgggactga

DBGET integrated database retrieval system