KEGG   Sinorhizobium meliloti 1021: SMc02861Help
Entry
SMc02861          CDS       T00058                                 

Gene name
pit
Definition
(RefSeq) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SMc02861 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 1231817
NCBI-ProteinID: NP_384292
RhizoBase: SMc02861
UniProt: O30499
Position
complement(214914..215918)
Genome map
AA seq 334 aa AA seqDB search
MDATLAFPLLVGLIAVALFFDFLNGLHDAANSIATIVSTRVLRPQYAVFWAAFFNFIAFL
FFGLHVAETLGTGIIDPGIVTPQVIFAALMGAITWNIVTWVFGIPSSSSHALIGGLVGAG
LAKTGFSSIVWQGLLKTAGAIVMSPGIGFVLALLLVLIVSWLFVRQTPFAVDSTFRVLQF
VSASLYSLGHGGNDAQKTMGIIAVLLFSQGYLGSEFYVPFWVVITCQAAIALGTLFGGWR
IVHTMGSKITKLNPMQGFCAETGGAITLFAATWLGIPVSTTHTITGAIIGVGAARRVSAV
RWGLAGNIVVAWVITMPAAALISALCYFAADLVA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgacgctcgccttcccgctgctcgtggggctcatcgccgtcgcgcttttcttc
gacttcctcaacgggttgcacgacgcggccaattccatcgcaaccatcgtatcgacccgc
gtgctccggccgcaatatgcggtcttctgggcggcgttcttcaacttcatcgccttcctc
ttcttcgggctgcacgtcgccgaaacgctcggaaccggcatcatcgatccgggtatcgtc
acgccgcaggtgatcttcgcggcgctgatgggcgccatcacctggaacatcgttacctgg
gtcttcggcatcccatcgagttcctcgcacgcgctcatcggcggtctcgtcggcgccggc
ctggccaagaccggtttcagttccatcgtctggcaaggcctgctgaagacggccggcgcc
atcgtcatgtcgccgggcatcggcttcgttctggcgctgctgttggtgctgatcgtctcc
tggctgttcgttcgccagacaccctttgccgtcgacagcaccttccgggtgctgcaattc
gtttcggcttccctctattcgctcggccatggcggcaacgatgcgcagaagaccatgggc
atcattgccgtgcttctcttctcgcagggctatctcggctcggaattctacgtgcccttc
tgggtggtcatcacctgccaggcggcgatcgcgctcggcacgctcttcggcggctggaga
atcgtccacacgatgggctcgaagatcaccaagctcaacccgatgcagggattctgcgcc
gagacgggcggcgccatcacgctgttcgccgcgacctggctcggcattccggtttcgacc
acccacacaatcaccggcgcgatcatcggcgtcggcgcggcgcggcgcgtatcggcggtg
cggtgggggcttgccggcaacatcgtcgttgcctgggtgatcaccatgccggcggcagcg
ttgatctcggcgctctgctatttcgccgcggacctcgtcgcctga

DBGET integrated database retrieval system