KEGG   Sinorhizobium meliloti 1021: SMc03061
Entry
SMc03061          CDS       T00058                                 

Gene name
aglE
Definition
(RefSeq) alpha-glucoside ABC transporter periplasmic-binding protein
  KO
K10232  alpha-glucoside transport system substrate-binding protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SMc03061 (aglE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SMc03061 (aglE)
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   alpha-Glucoside transporter
    SMc03061 (aglE)
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8 SBP_bac_11
Other DBs
NCBI-GeneID: 1232334
NCBI-ProteinID: NP_384801
RhizoBase: SMc03061
UniProt: Q9Z3R5
Position
757756..759132
AA seq 458 aa
MKRSLLIGVAAFALLAGTAGLAGTAGAADLKFKPGEDSRFNWASLEEFKKGHDLKGQTLT
IFGPWRGEDEALFKSVYAYFVEATGVELKYSSSENYEQQIVIDTQAGSPPDVAILPQPGL
IADLAAKGLLTPLGDETKQWLLDNYAAGQSWVDLSTYNGKDGTSALYAFPYKIDVKSLVW
YVPENFEDAGYEVPKTMEELKALTEKIAEDGEKPWCIGLGSGGATGWPATDWVEDLMLRT
QPAETYDKWVKNEIPFTDAAVTGALEEFGWFARNDAFVDGGAAAVASTDFRDSPKGLFSS
PPKCYLHHQASFIPSFFPEGKVVGEDADFFYMPPYESKKELGNPVLGAGTLAMITKDTPA
ARAFIEFLKTPIAHEVWMAQTSFLTPYKSVNVDVYGNPPLKKQGEILLNATTFRFDGSDL
MPGKIGAGAFWTGMVDFVGGKSSADVAAGVQKAWDSIK
NT seq 1377 nt   +upstreamnt  +downstreamnt
gtgaagagatcattgctgatcggcgtggccgcattcgcattgcttgcagggactgctggg
cttgcagggactgccggcgccgccgacctgaaattcaagccgggagaggattccaggttc
aactgggcgagcctggaggagttcaagaagggtcacgacctcaagggtcagacgctcacc
atcttcggtccctggcgcggcgaggacgaggctctgttcaagagcgtctatgcctatttc
gtcgaggcgaccggcgtggagctcaaatattcctcctcggaaaactacgagcagcagatc
gtcatcgatacgcaggcgggaagcccgcctgatgtcgcaatcctgccgcagccgggtctc
atcgccgatctggccgccaagggccttctgacgccgctcggcgacgaaaccaagcaatgg
ctcctcgacaactatgctgcaggccagtcctgggtcgacctctccacctataacggcaag
gacggaacgtccgcgctttacgccttcccgtacaagatcgacgtcaagtctctcgtctgg
tacgtgccggagaacttcgaggatgccggctacgaagtgcccaagaccatggaagaattg
aaagcgctgacggagaagatcgccgaagacggcgaaaagccgtggtgcatcggtctcggt
tcgggcggcgcgaccggttggccggcgaccgactgggtcgaggacctgatgctgcggacc
cagcccgccgagacctacgacaaatgggtgaagaacgagatacccttcacggatgcggcg
gtcacgggtgcactggaggagttcggctggttcgcgcgcaatgacgccttcgtcgacggc
ggcgcagcggcggtggcgtcgaccgacttccgggacagcccgaaaggcctcttcagttct
ccgccgaagtgctacctgcaccaccaggcctcgttcattccgtccttcttcccggaaggc
aaggtcgtcggagaggatgccgacttcttctacatgccgccttatgaaagcaaaaaggag
ctcggtaatccggtgctcggcgcaggcacgcttgcgatgatcaccaaggacacgccggcg
gcacgcgccttcatcgagttcctgaagaccccgatcgcgcacgaggtctggatggcgcag
acgagcttcctcacgccttacaagagcgtcaatgtcgacgtctacggaaatccgccgctg
aagaaacagggtgaaatcctgctgaacgccacgacgttccgcttcgacggctccgacctg
atgcccggcaagatcggcgccggcgccttctggaccggcatggtcgatttcgtcgggggc
aagtcctcggccgacgtcgcggccggcgtacagaaggcatgggactccatcaagtaa

DBGET integrated database retrieval system