KEGG   Sinorhizobium meliloti 1021: SMc03062
Entry
SMc03062          CDS       T00058                                 

Gene name
aglF
Definition
(RefSeq) alpha-glucoside ABC transporter permease
  KO
K10233  alpha-glucoside transport system permease protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SMc03062 (aglF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SMc03062 (aglF)
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   alpha-Glucoside transporter
    SMc03062 (aglF)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 1232335
NCBI-ProteinID: NP_384802
RhizoBase: SMc03062
UniProt: Q9Z3R6
Position
759384..760394
AA seq 336 aa
MEQLIAAILTMVAGVLVCAAYFWSTNLVLDWIFPSKGKFGAVASRNLRIANSIRPWLFLA
PALLALTLYLVYPVVQSVWLSLHGRGGQNFVGLSNYSWMINDGEFRQSIFNNFLWLLVVP
ALSTFFGLIIAALTDRIWWGNIAKTLIFMPMAISFVGAAVIWKFIYDYRAAGSEQIGLLN
AIVVALGGEPQAWITLPFWNNFFLMVILIWIQTGFAMVILSAALRGIPEETIEAAVIDGA
NGWQIFFKIMVPQIWGTIAVVWTTITILVLKVFDIVLAMTNGQWQSQVLANLMFDWMFRG
GGDFGRGAAIAVVIMILVVPIMIWNIRNATRESGGH
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggaacagttgattgctgccattctgacgatggtggccggcgttctggtctgcgcggcc
tatttctggagcacgaatctcgttctcgactggatcttcccctccaaggggaagttcggg
gccgtcgcctcgcgcaacctgcgtatcgccaacagcattcgtccctggctgtttctcgcc
cccgccctgctggcgctgacgctctacctcgtctaccccgtcgtccaatcggtctggctg
agccttcacggtcggggaggccagaacttcgtcggcctgagcaactattcctggatgatc
aatgacggcgaattccgccagtcgatcttcaacaatttcctctggctcctcgtcgtgccg
gcgctttcgaccttcttcggcctgatcattgcggcactgaccgaccgcatctggtggggc
aatatcgccaagacgctgatcttcatgccgatggcgatttccttcgtcggcgcagccgtc
atctggaaattcatctatgattaccgcgccgcaggctccgaacagatcggtctcctgaac
gccatcgtcgtcgcgcttggcggcgagccgcaggcctggatcacgctgcccttctggaac
aacttcttcctgatggtcatcctcatctggatccagaccggctttgccatggtcatcctt
tcggcggcgctgcgcggcattccggaggagacgatcgaggcggcggtcatcgacggcgcc
aatggctggcagattttcttcaagatcatggtgccgcagatctggggcacgatcgccgtc
gtgtggacgaccatcaccatcctggtcctcaaggttttcgatatcgtgctggcgatgacg
aacgggcaatggcagagccaggtgcttgccaatctcatgttcgactggatgttccgcggc
ggcggcgacttcggccgaggcgcggcaatcgcggtggtcatcatgatcctggtcgtcccg
atcatgatctggaacatccgcaacgcgaccagggaatcgggaggccactga

DBGET integrated database retrieval system