KEGG   Sinorhizobium meliloti 1021: SMc03065
Entry
SMc03065          CDS       T00058                                 
Symbol
aglK
Name
(GenBank) Alpha-glucosides ABC transporter, ATP binding component
  KO
K10235  alpha-glucoside transport system ATP-binding protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SMc03065 (aglK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SMc03065 (aglK)
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Alpha-glucoside transporter
    SMc03065 (aglK)
SSDB
Motif
Pfam: ABC_tran OB_MalK TOBE TOBE_2 RsgA_GTPase AAA_21 CysA_C_terminal SMC_N AAA_16 AAA_29 AAA_22 MMR_HSR1 AAA_23 AAA_33 AAA_25 AAA_28 Rad17 AAA AAA_30 NACHT ATPase_2 RNA_helicase AAA_15 NB-ARC AAA_18
Other DBs
NCBI-ProteinID: CAC45271
RhizoBase: SMc03065
UniProt: Q9Z3R9
Position
763243..764331
AA seq 362 aa
MTGLLLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDM
FIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADM
LQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLS
ERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAM
NVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDFLFEG
TVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFDTNGQSY
RA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgacaggcctgctgctgaaagatatccgcaagtcctacggggccgtcgacgtaattcac
ggcatcgatctcgacatcaaggaaggcgagttcgtcgtcttcgtaggaccgtccggatgc
gggaagtcgacacttctgcgcatgatcgccgggctcgaggaaataaccggcggcgacatg
ttcatcgacggcgagcgggtcaacgacgtgccgccttcgaagcgcggcatcgccatggtg
ttccagtcctatgcgctctatccgcatatgaccgtttacgacaacatggccttcggcatg
cgcatcgccagggaatcgaaggaggagatcgaccggcgtgtgcgtggagccgcggatatg
cttcagctcaccccatatctcgaccggcttccgaaggcgctttccggcggccagcggcag
cgcgtggccatcggccgggcgatctgccgcaatcccaaggtcttccttttcgacgagccg
ctctccaacctcgacgccgcgctccgggtagcgacccgcatcgagatcgccaagctcagc
gagcggatgtcggacaccaccatgatctacgtcacccatgaccaggtggaggcgatgacg
ctcgccgaccggatcgtggtcctctccgccggtcacatcgaacaggtcggggcgcccctc
gaactctacgagcggccggcaaacctcttcgtcgcgcgtttcatcggctccccggccatg
aacgtcatcccggcgacgatcactgccaccggccaacagaccgccgtctcgctcgcgggc
ggaaagtcggtgacgctcgatgttccgacgaatgcctccgaaaacggcaagacggcgagc
ttcggcgtccgcccggaagacctgcgggtgaccgaggccgacgacttcctgttcgagggc
acggtctcgatcgtcgaggcgctgggcgaggtgaccttgctctacatcgaagggctggtc
gaaaacgagccgatcatcgccaagatgcccggtatcgcccgggtcggccgcggcgacaag
gtgcggttcacggccgacaaggccaagctgcatctcttcgacaccaatggacagagctat
cgggcgtag

DBGET integrated database retrieval system