KEGG   Sinorhizobium meliloti 1021: SMc03105Help
Entry
SMc03105          CDS       T00058                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00900  Terpenoid backbone biosynthesis
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMc03105 (dxr)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SMc03105 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-GeneID: 1234672
NCBI-ProteinID: NP_387094
RhizoBase: SMc03105
UniProt: Q92LP6
Position
3235946..3237121
Genome map
AA seq 391 aa AA seqDB search
MASGDDLKRRLTILGSTGSIGTSTLDVIERLGGRDRFEIAALTGNGNIPLLAEQARRIGA
ELAVTADEDRYGELKDALSGSGIEVAAGRSGLTEAAERDAGWVMAAIVGNAGLGPTLAAA
RRGADIALANKECLVSAGSLFIDAVAEGGGRLLPVDSEHNAIFQVLENDQRHAVERIVLT
ASGGPFRTKTLDEMRHVTADVARAHPNWSMGLKISIDSASMFNKALEMIEARHLFRLRPE
QIEVIVHPQSVVHSMVGYTDGSVLAQLGCPDMRTAIGYALSYPKRCDLPVERLDFARLAR
LDFEAPDEVRFPAIKLARRAMEEGGVQGAVLNGAKETALDAFIKGRIGFLAMAEIVEKVM
DGLAGLPAATSMDDVFAADERARRAAAEMIR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggcgatgacttgaagcgccgtctgacgatattgggctccaccggatcgatc
gggaccagcacgctcgacgtgatcgagcgcctcggcggacgcgatcgtttcgagatcgcc
gccctgaccggcaacggcaatataccgctgctggccgagcaggcgcgccgcatcggcgcc
gagctcgcggtaaccgccgacgaggatcgctatggcgagctcaaggatgcgctgagcggc
agcggcatcgaggtcgccgccggacgaagcggcctcaccgaagcggccgagcgggatgcc
ggctgggtcatggcggcgatcgtcggcaatgccggcctcggccccaccctggcggctgcc
cgccgcggcgcagacatcgcgcttgccaacaaggaatgtctcgtttccgccggcagcctt
ttcatcgatgccgtggccgagggcggcggccggttgctgcccgtcgacagcgaacacaat
gcgatcttccaggtgctggaaaacgatcagcgccacgccgtggaacgcattgtcctcacc
gcttccggcggccctttccgcaccaagacgctcgacgaaatgcggcacgtgaccgcggat
gtggcccgcgcccatccgaactggtcgatgggcctcaagatatcgatcgacagcgcctcg
atgttcaacaaggcgctcgagatgatcgaggcgcgccacctcttccgtctcaggccggag
cagatcgaggtgatcgtccacccgcaatcggtggttcactccatggtcggctatacggac
ggctccgtactcgcacagctcggctgccccgacatgcgcaccgcaatcggctatgccctg
tcctacccgaaacgctgcgacctgccggtcgagcgcctcgacttcgccaggctcgcccgg
cttgatttcgaggcgccggacgaggtccgcttcccggcgatcaaactcgcgcgccgggca
atggaggaaggcggcgtgcagggcgcggtgctgaacggcgccaaggagaccgccctcgat
gccttcatcaagggccgcatcggcttcctcgccatggcggaaatcgtcgaaaaggtgatg
gacgggcttgccggcctgccggccgccacgagcatggacgacgtctttgcggccgatgaa
agagcccggcgggcggctgccgagatgatccggtag

DBGET integrated database retrieval system