KEGG   Sinorhizobium meliloti 1021: SMc03232Help
Entry
SMc03232          CDS       T00058                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00860  Porphyrin and chlorophyll metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMc03232 (hemD)
Enzymes [BR:sme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SMc03232 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 1234764
NCBI-ProteinID: NP_387186
RhizoBase: SMc03232
UniProt: Q92LH6
Position
3340460..3341167
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPRPAAERTAARLSAMGHEAVILPLMQAQHLAGAARAALSEPHQAIAVSSGEAV
RVLGALGPALEPHLATPLFAVGEATARAAGDLGFTDVRIGPGTGEGLAETVAALLPPGET
LVYLAGSPRTDGFERALHQRRIEHRTAECYRMAPVHYPAETLPGLLRAGPFDAVMLYSRE
SARRLDAALRESGLEPADLASRFLCLSWPIRETLPDGLPCGVAAVPDEENLLRLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtgacccggccacgcccggccgccgaaaggacggcggcaaggctcagc
gccatgggtcacgaagcggtcatcctgccgcttatgcaggcgcagcatctcgccggcgcg
gcccgggcagcattgagtgagccccaccaggcgatcgccgtcagcagtggggaggcggtc
cgcgtcctcggcgcgctcggaccggcgcttgagccacaccttgcaactccgctctttgca
gtcggcgaagcgacggcgcgcgctgcgggcgatctcggatttaccgatgtccgcatcgga
ccgggaaccggcgaaggactcgccgagacggtggctgcccttctcccccccggcgaaacg
ctggtctatctcgccggttcaccgcgaaccgacggtttcgaacgggcattgcaccaacgg
cggatcgagcacaggaccgccgaatgctaccggatggcgccggtccactatcctgcggag
acgctgcccggactcctccgcgcgggccccttcgatgcggtcatgctctattcccgcgag
agcgcgcggcgcctggacgcagcattgcgggagagcgggcttgaacccgcggacctcgcc
tcgcgctttctctgcctgagctggccgataagagagaccctgccggacggtctaccctgc
ggggtcgcggcggtgccagacgaggaaaatctcttgcggcttctttga

DBGET integrated database retrieval system