KEGG   Sinorhizobium meliloti 1021: SMc03896Help
Entry
SMc03896          CDS       T00058                                 

Definition
(RefSeq) transcriptional regulator
  KO
K07782  LuxR family transcriptional regulator, quorum-sensing system regulator SdiA
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02020  Two-component system
sme02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMc03896
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SMc03896
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sme03000]
    SMc03896
Transcription factors [BR:sme03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    SMc03896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autoind_bind GerE HTH_23
Motif
Other DBs
NCBI-GeneID: 1234973
NCBI-ProteinID: NP_387385
RhizoBase: SMc03896
UniProt: Q92L12
Position
complement(3566370..3566924)
Genome map
AA seq 184 aa AA seqDB search
MGATPIRKKYVVIDPTIRFLGHAQRGFRWRDTLVAFRSDPHRKRMESMMVEARNHGLFDG
YIFPVHGRRGLMGNLTVGGRVVDLSPVELSLFDAIAKRLFWKLLELTDPEIMAELVSRVE
VQMTRREMEALHYLADGMTSNDIGKVLDISSHTVDWYMNGIQEKLKAKNRHHVVAIAFRL
GLIS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgggggcaactccaatccgcaagaaatacgtcgttatcgatccgaccattcgcttcctc
gggcatgcccagcgcggcttccgctggcgcgacacgctcgtggcattccgctcggacccg
caccgcaagcgcatggaaagcatgatggtcgaggcgcgcaatcatggcctcttcgacggc
tatatctttccggtccacggccggcgcgggctcatgggcaacctgaccgtcggcggccgg
gtggtcgatctgagcccggtggagttgagccttttcgacgccattgccaagcggctgttc
tggaagctgctcgaactcaccgatccggagatcatggcggaacttgtctcccgcgtcgaa
gtccagatgacgcggcgcgaaatggaggcgctccactatctcgccgacggaatgacctcg
aacgacatcggcaaggtcctcgacatttccagccacacggtcgactggtacatgaacggc
atccaggaaaagttgaaggcgaagaaccgccatcacgtcgtggcgatcgccttccgcctg
ggactgatctcctga

DBGET integrated database retrieval system