KEGG   Sinorhizobium meliloti 1021: SMc04029Help
Entry
SMc04029          CDS       T00058                                 

Definition
(RefSeq) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00260  Glycine, serine and threonine metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
sme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMc04029
Enzymes [BR:sme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SMc04029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC DUF5130 Aminotran_1_2 FliC_SP
Motif
Other DBs
NCBI-GeneID: 1234488
NCBI-ProteinID: NP_386918
RhizoBase: SMc04029
UniProt: Q92M44
Position
3032007..3033053
Genome map
AA seq 348 aa AA seqDB search
MIFSSDNWAGAHPAIAESLVANAQGYASAYGTSELDRRVEQRFSEIFERDVAVFFVGTGT
AANSLALSSANRAGGIAFCHREAHVNVDECGAPEFFSHGARLCPVEGARGRMEPAKLEAE
IRRLPRENVHGGQPMAVTLTQATESGTVYSLDQIETIGSIARSHKLPLHMDGARFANALV
SLGTTPAEMTWKRGVDLLSFGGTKNGCWCAEALVLFDLSKAQEMHFLRKRSAQLFSKSRF
VAAQFDAYLAGDLWLDLARHANAMAQRLADGITASAGSRLAWAPDANEVFVVLKREAAGR
LQRQGALFYDWEVPHDLEGSLAEDEGLYRLVTSFATRAEDVDRFVAAC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatcttctcctccgacaactgggccggcgcccatccggcgattgccgaaagtctggtc
gcgaatgcgcagggctatgcttccgcctacggcacgagcgaactcgaccggagggtggaa
cagagattttcggagattttcgagagggacgtcgcggtattcttcgtgggcaccggaacc
gccgcaaattcccttgcgctttcgagcgccaatcgggcgggcggaatcgctttctgccat
cgcgaagcgcatgtgaacgtcgacgagtgcggcgcgccggagttcttctcgcacggcgcg
aggctgtgcccggtcgagggcgcccgcggcaggatggagccggcgaagctcgaggccgaa
attcggcggctcccgagggagaacgtccatggcggtcagccgatggcggtgacgctgacg
caggcgaccgagagcggcaccgtctattcgctcgaccagatcgaaacgatcggttcgatc
gcccgctcccataaactgccgctgcacatggatggcgcccgtttcgccaatgccctggtc
agccttggtacgacaccggccgagatgacctggaagcgtggcgtcgatctgctttcgttc
ggcggaaccaagaacggctgctggtgcgccgaggcgctggtgctcttcgacctttcgaag
gcgcaggagatgcacttcctgcgcaagcgctcggctcaactcttctccaagtcgcgcttc
gtcgccgcccagttcgacgcctatcttgccggcgatctctggctcgatcttgcgcgccac
gccaacgcgatggcacagcgcctcgccgacggcatcaccgcttcggccgggagccggctt
gcctgggcgcccgatgccaacgaggtcttcgtcgtgctgaaacgggaggccgcgggtcgg
ctgcagcggcagggcgcgcttttctacgattgggaagtgccgcacgatctcgaaggcagc
ctcgcggaagacgaagggctctatcgcctggttaccagcttcgccacccgcgccgaggac
gtcgaccgtttcgtcgccgcctgctga

DBGET integrated database retrieval system