KEGG   Sinorhizobium meliloti 1021: SMc04400
Entry
SMc04400          CDS       T00058                                 

Gene name
afr
Definition
(GenBank) 1,5-anhydro-D-fructose reductase
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMc04400 (afr)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     SMc04400 (afr)
SSDB
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C NAD_binding_3
Other DBs
NCBI-ProteinID: CAC47884
RhizoBase: SMc04400
UniProt: Q92KZ3
Structure
PDB: 
4KOA

Position
complement(3605092..3606093)
AA seq 333 aa
MIRWGLIGASTIAREWVIGAIRAAGGEVVSVMSSSAERGEAYAAENGIAKAVTSVDDLVG
DPDVDAVYISTTNELHHGQALAAIRAGKHVLCEKPLAMNLNDGCEMVLKACEAGVVLGTN
HHLRNAATHRAMREAIAAGRIGRPIAARVFHAVYLPPHLQGWRLDKPEAGGGVILDITVH
DADTLRFVLNDDPIEAVAISHSAGMGKEGLEDGVMGVLRFRSGVIAQFHDAFTTKFAETG
LEVHGTAGSLIGRNVMTQRPVGTVVLRNEEGESELPLDHRNLYETAIAAFHSAIGGNGRP
SASGEDGVWSLATGLAVVKAAATGGAVEIETGL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgattcgctggggactgatcggcgcgagcacgatcgcgcgcgaatgggtgatcggcgcc
atccgcgccgcaggcggcgaagtcgtctcggtgatgagctcgagcgcggaacgaggagag
gcctatgccgcggagaacgggatcgcaaaggctgtgacaagcgtcgacgatctcgtcggc
gatcccgacgtggacgccgtctacatctcgacgaccaacgagcttcaccacggccaggcg
ctggcagcgatccgcgccggcaagcacgttctctgcgagaagccgctggcgatgaacctc
aatgacggctgtgaaatggtgctcaaggcctgtgaggccggcgtcgtgctcggcaccaat
catcacttgcgcaatgccgccacgcatcgggccatgcgggaagcgatcgccgcgggccgg
atcggccggccgatcgcggcgcgggtcttccatgccgtctatctgccgccgcacctccag
ggctggcggctcgacaagccggaggcgggcggcggcgtcattctcgatatcaccgtgcac
gacgccgacacgctgcgcttcgttctgaacgacgacccgatcgaggccgtcgcgatcagc
cacagcgccggcatgggcaaggaaggactcgaggacggggtcatgggcgtgctccgcttc
cgctccggcgtcatcgcccagttccatgatgccttcaccacgaaatttgccgagacgggt
ctcgaagtgcacggaaccgcgggatcgctgatcggccgcaacgtgatgacgcagcggcct
gtcggcacggtcgtgctgcgcaatgaagagggcgagagcgagttgccgctcgaccaccgc
aatctctacgagacggcgatcgcggctttccattcggcgatcgggggcaatggccgtccg
tcggcgagcggtgaggatggcgtctggtcgctcgccaccggccttgcggtggtcaaggcg
gccgccaccggcggtgccgtcgagatcgaaacgggactttga

DBGET integrated database retrieval system