KEGG   Sinorhizobium meliloti 1021: SMc04462Help
Entry
SMc04462          CDS       T00058                                 

Definition
(RefSeq) glycerate dehydrogenase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 BHD_2
Motif
Other DBs
NCBI-GeneID: 1234543
NCBI-ProteinID: NP_386972
RhizoBase: SMc04462
UniProt: Q92LZ4
Structure
PDB: 

Position
complement(3095842..3096810)
Genome map
AA seq 322 aa AA seqDB search
MSRPRILVPGKINPRVLERLPEMFETVRIERADAALVTADMRDVSGIAVSGKLPVPLMDA
FPSLEIVANFGVGYDGVDVSRAAARGIVVTNTPDVLTEEVADTAIGLLLNTLRLLPQAEQ
WLRQGRWVREGAFPLSPLSLRGRTVGLFGLGRIGLAIARRLEAFGVSIAYHTRTPREGLG
FTYHPTLVGMAEAVDTLIVIVPGTASTLKAVNADVLSALGPKGVLINVGRGSTVDEAALV
TALQNGTIAGAGLDVFENEPNVPEALLSFPNVSLLPHVASASVVTRNAMSDLVVDNLKAW
FSTGEALTPVAETPFRRRAIQN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcctagaattctcgtgcccgggaagatcaacccgagggtcctcgaacgattg
ccggaaatgttcgagaccgtgcgcatcgagcgcgccgatgcggccctcgtgacagccgac
atgcgcgacgtttccggcattgccgtttcgggcaagctgccggtgccgctgatggatgca
ttccccagcctcgagatcgttgcgaatttcggcgtcggctacgacggcgtcgatgtctcg
cgtgcagcagcccgagggattgtcgtcaccaatacgcctgatgtcctgaccgaggaagtc
gccgacacggccatcggcctcctcctcaacacgctgcgcctcctgccgcaggccgagcaa
tggctgcgccaaggccgctgggtgcgcgagggggccttcccgctatccccgctttcgctc
cgcggccgtacggtcgggctgttcggcctcggccggatcggcctcgcgatcgcacggcgg
ctcgaagccttcggcgtctcgatcgcctaccacacgcgcacgccgcgcgaaggcctcggc
ttcacctatcatccgaccctcgtgggtatggccgaggccgtcgacacgctcattgtcatc
gtgcccggaacagcgagcacgctgaaagcggtcaatgccgatgttctttcggcgctcggc
ccgaagggcgtgctgatcaatgtgggtcgcggctcgacggtggacgaggcggcgcttgtc
accgcacttcagaacggcaccattgccggcgccggcctcgacgtcttcgagaacgagccc
aatgttcccgaggcgctgctttcgtttccgaacgtctctctgctgccgcatgtggcgtcg
gcctctgtcgtcacccgcaacgccatgtccgatctcgtcgtcgacaacctgaaggcatgg
ttctcgaccggtgaagctttgacaccggtggccgagacgccgttccggcgtagagcgatc
caaaactaa

DBGET integrated database retrieval system