KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr0530Help
Entry
C770_GR4Chr0530   CDS       T02405                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00071  Fatty acid degradation
smeg00072  Synthesis and degradation of ketone bodies
smeg00280  Valine, leucine and isoleucine degradation
smeg00310  Lysine degradation
smeg00362  Benzoate degradation
smeg00380  Tryptophan metabolism
smeg00620  Pyruvate metabolism
smeg00630  Glyoxylate and dicarboxylate metabolism
smeg00640  Propanoate metabolism
smeg00650  Butanoate metabolism
smeg00900  Terpenoid backbone biosynthesis
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
smeg01200  Carbon metabolism
smeg01212  Fatty acid metabolism
smeg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C770_GR4Chr0530
   00630 Glyoxylate and dicarboxylate metabolism
    C770_GR4Chr0530
   00640 Propanoate metabolism
    C770_GR4Chr0530
   00650 Butanoate metabolism
    C770_GR4Chr0530
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C770_GR4Chr0530
   00072 Synthesis and degradation of ketone bodies
    C770_GR4Chr0530
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C770_GR4Chr0530
   00310 Lysine degradation
    C770_GR4Chr0530
   00380 Tryptophan metabolism
    C770_GR4Chr0530
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C770_GR4Chr0530
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C770_GR4Chr0530
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C770_GR4Chr0530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smeg04147]
    C770_GR4Chr0530
Enzymes [BR:smeg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C770_GR4Chr0530
Exosome [BR:smeg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C770_GR4Chr0530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGA05502
Position
complement(565174..566382)
Genome map
AA seq 402 aa AA seqDB search
MTKVFVYDHVRTPRGRGKKDGALHEVPSVRLAAKVLEAVRDRNGLDTSTVDDVIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANA
WEKGYFKNSVVPVKDQNGLVILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAAAVLIGSKAGGEAMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRYCQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcttcgtttacgaccacgtgcgcacgccgcgcggccgtggcaagaaggac
ggcgcgctgcacgaggtgccctccgtgcggctcgcggccaaggtgctcgaggccgtgcgc
gatcgcaacgggctcgacacttcgacggtcgacgacgtcatcatgggttgcgtcgacccg
gtcatggatgcgggtgcggtcatcccgaaagctgcagccttcgaggccggctattcgacg
cgtgcgcccggcatgcagatctcccgcttctgcgcctccggcctcgacgcggtcaatttc
ggcgctgcgaagatcgcacaaggagcggacgacatcgtgatcgccggcggcgtcgagtcg
atgtcccgcgtcggcctgggcatgtcgggcggcgcctggttcatggacccctcggtcaac
ctgcccgcctatttcatgccgcagggcgtttcggccgacctgatcgccacgaaatacggt
ttctcgcgcgacgacgtcgacgcctatgcggtggaaagccagaagcgcgccgccaatgcc
tgggagaagggttatttcaagaactcggtcgtcccggtcaaggaccagaacggcctggtc
attctcgaccgcgacgagcatatgcgccccggcaccgacatgcaggcgctggcctcgctc
aacccttccttccagatgcccggcgagatgggcggcttcgaggccgtcggcatccaggcg
catccggagatcgagcgcatcaactatgtccaccacgccggcaattcctccggcatcgtc
gatggcgccgcggccgtgctcatcggctccaaggccggcggcgaagccatggggctcaaa
ccccgcgcccgcatccgcgccttcgccaatatcggctccgacccggccctgatgctgacc
gggccggtcgacgtcaccgagaagctcctgaagcgggccgacatgaagctctccgacatc
gacctgttcgagctcaatgaggccttcgcggccgtcgtgctgcgctactgccaggctttc
gacatcccgcacgataagatcaacgtcaatggcggcgcgatcgccatgggccatccgctc
ggcgcgaccggggcgatgatcctcggcaccgtgctcgacgagctggagcgccgcgacctc
aacacggcgctggtgacgctctgcatcggcgccggcatgggcaccgccacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system