KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr1577Help
Entry
C770_GR4Chr1577   CDS       T02405                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C770_GR4Chr1577
Enzymes [BR:smeg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C770_GR4Chr1577
Transporters [BR:smeg02000]
 Other Transporters
  Pores ion channels [TC:1]
   C770_GR4Chr1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_N_2 GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AGA06526
Position
1649914..1650552
Genome map
AA seq 212 aa AA seqDB search
MTGRPRLFGAEYSVYVRIVRLALAEKGTDYELVPVDIFASDGPPQDYLERHPFGRIPAFE
YEGFRLYETGAITRYVDDVFDGRRLQPPDPRERARCSQLMSIADNYAYPTLVWGVYVERV
SKPASGAAADENAIAAALPKARTCLKAISEIMGTAPWLAGETMSLADLYAAPIFDYFLRA
PEGQEMLREHEMLAAWWARMSVRRSMMETRPA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaggccgcgcctgttcggagcggagtacagcgtttacgtgcggatcgtgcgg
ctggcgctggccgagaagggaacggactacgaactcgtccccgtagacatcttcgcgagc
gatggcccgccacaggactatctggagcggcatcccttcggtcgcatccctgccttcgaa
tatgagggcttcaggctttacgagaccggcgcgataacgcgctacgtcgatgacgtgttc
gacgggaggaggcttcaacctcccgatccgcgggagcgcgcccgctgcagccagctgatg
agtatcgccgacaactacgcctatcccactctggtctggggagtctacgtggaacgcgtc
tcaaagccggcgagcggcgcggccgctgacgagaacgcaatcgccgctgcgctgccgaaa
gcaaggacctgcctcaaggcgatttccgaaattatgggaacggcgccatggctcgcaggc
gagaccatgtcgctcgccgacctctatgccgccccgatattcgactatttcctcagggcg
ccggaagggcaggaaatgctccgggagcacgagatgctggcggcgtggtgggcgcggatg
tcggtgaggcgctcgatgatggagacgcggcccgcatag

DBGET integrated database retrieval system