KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2256Help
Entry
C770_GR4Chr2256   CDS       T02405                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase, prokaryotic form
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00670  One carbon pool by folate
smeg01100  Metabolic pathways
smeg01120  Microbial metabolism in diverse environments
smeg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C770_GR4Chr2256
Enzymes [BR:smeg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     C770_GR4Chr2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AGA07181
Position
complement(2347196..2348137)
Genome map
AA seq 313 aa AA seqDB search
MNGRTPYPVDCDGLRFSFEYFPPKNDEMETQLFQTVTALSVFAPAFVTVTYGAGGSTKAR
SLTTVKRMIGEMEIANTAAHLTCVGAPKAEVDAVIDEFLACGVRHFVALRGDPQGGIGSV
YEPFPGGYENAAALVKALRARGDFEISVSAYPEKHPESPDVAADIDMLKRKVDNGATRAL
TQFFFDNDDFERYLERVRRAGIAIPIVPGILPINNLTQVQKFAGLCGARVPESIVSRLGP
IDDQPEERFREAAHIAAEQVADLVRRGVSDFHLYTMNRPQLITAVCELMGYDPEIAPAQP
ADTERSVRAVARA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaacggacggacgccttaccccgtggactgtgacgggcttagattttccttcgagtac
ttcccgccgaagaacgacgagatggagacgcagctctttcagacagtcacggccctctcc
gttttcgcgcccgccttcgtcaccgtcacctacggtgccggcgggtcgaccaaggcacgc
tccctgacgacggtcaagcggatgatcggcgagatggagatcgcgaatacggcggcgcac
ctcacttgcgtcggcgcgccgaaggcggaggtggatgcggtcatcgacgagttcctggcc
tgcggcgtgcgccatttcgtggcattgaggggtgatccgcaaggcggtatcggcagcgtc
tacgagccttttccgggcggctatgagaatgccgccgccctcgtcaaggccctgcgggcg
cgcggcgatttcgagatctccgtctccgcctatccggaaaagcatccggagagccccgac
gtcgctgccgacatagacatgttgaagcgcaaggtcgacaatggcgcaacgcgcgcgctt
acgcagttcttcttcgacaatgacgacttcgagcgctatctcgaacgcgtaaggcgtgcg
ggcatcgcgataccgatcgtacccgggatactgccgatcaataatctcacccaggtgcag
aaatttgccggtctttgcggcgccagagttccggagtcgatcgtttcgcggctgggccct
attgacgatcagccggaggagcgcttccgggaggcggcccatatcgcggccgaacaggtc
gccgatctcgtccggcgcggcgtcagcgattttcacctctacacgatgaaccgcccgcag
ctgatcaccgccgtttgcgaactgatgggctatgatccggaaatcgcgccggctcagccg
gccgacacggagcgctcagtccgggcggtcgcgagggcatga

DBGET integrated database retrieval system