KEGG   Sinorhizobium meliloti GR4: C770_GR4Chr2492Help
Entry
C770_GR4Chr2492   CDS       T02405                                 

Definition
(GenBank) Formyltetrahydrofolate synthetase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00670  One carbon pool by folate
smeg01100  Metabolic pathways
smeg01120  Microbial metabolism in diverse environments
smeg01200  Carbon metabolism
Module
smeg_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C770_GR4Chr2492
Enzymes [BR:smeg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     C770_GR4Chr2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AGA07411
Position
complement(2618388..2620094)
Genome map
AA seq 568 aa AA seqDB search
MREANWGEAVGEVKSDIEIARAARKQPIMEVGAKLGIPPEHLLPYGHDKAKVSAEFIAAQ
NEKRNGRLILVTAINPTPAGEGKTTTTVGLGDGLNRIGKKAIVCIREASLGPCFGIKGGA
AGGGYAQVVPMEDINLHFTGDFHAITSAHNLLSALIDNHIYWGNEQAIDIRRIAWRRVMD
MNDRALRQIVGSLGGVANGYPRETGFDITVASEVMAILCLAMDIKDLEKRLGNIIIGYRR
DKSPVFARDIKADGAMAVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVVATTTA
LKLADYVVTEAGFGADLGAEKFFDIKCRKAGLTPDAAVIVATVRAIKMNGGVKREDLGRE
SVEAVRKGCANLGRHIQNVKKFGVPVLVAINHFTSDTEAEVRAIKDYVRTLGSEAVLCKH
WAEGSAGIEELAYKVVDLANAGHSQFSPLYPDEMPLFQKIETIAKDIYHASEVIADKLVR
EQLRTWEDQGYGDLPICMAKTQYSFSTDPNLRGAPTGHAVPIREVRLAAGAGFIVVITGE
IMTMPGLPKVPSSERIRLNEQGYIEGLF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggcaaactggggggaagccgtgggagaggtaaagtccgacatcgagatcgcg
cgcgccgcgcgcaagcagccgatcatggaggtcggcgcgaagctcggcattccgccggag
catctgcttccctacggccatgacaaggccaaggtcagcgccgaattcatcgcggcgcaa
aacgagaaaaggaacggccggctcattctggtgacggcgatcaacccgacgccggcgggc
gagggcaagacgacgacgaccgtcggcctcggcgacggcttgaaccgcatcggcaagaag
gcgatcgtctgcatccgcgaggcgtcgctcggtccctgcttcggtatcaagggcggggcg
gcgggcggcggttacgcccaggttgtgccgatggaggacatcaatctccatttcaccggc
gatttccatgcgatcacgtcggcgcataatctgctctccgccttgatcgacaaccatatc
tattggggcaacgagcaggcgatcgacattcgccgcatcgcctggcggcgggtcatggac
atgaacgaccgggcgcttcgccagatcgtcggctccctcggcggcgtcgccaacggctat
ccaagagagaccggcttcgacatcaccgtcgcctcggaagtcatggcgatcctgtgcctg
gctatggacatcaaggatctcgaaaagcggctcggcaacatcattatcgggtaccgtcgt
gacaagagcccggtcttcgcccgggacatcaaggcggatggggcaatggcggtactgctc
aaggacgcgatgcagccgaacctggtgcagacgctcgagaacaaccccgccttcgtccat
ggcggccccttcgccaatatcgcgcatggctgcaattcggtcgtggccaccacgacggcg
ttgaagcttgccgactatgtggtaaccgaggccggcttcggtgccgatctcggcgccgag
aaattcttcgacatcaagtgccgcaaggcagggctcacgcccgatgccgccgtaatcgtc
gcgactgtccgcgcgatcaagatgaacggcggagtgaagagggaagacctcgggagagag
agcgtcgaggcggtcaggaaggggtgcgccaatctcggccgccacatccagaacgtcaag
aagttcggcgtaccggtgctcgtcgcgatcaaccatttcacctccgataccgaggccgag
gtccgggcgatcaaggattatgtcagaacgctcggttccgaagcggttctctgcaagcac
tgggccgagggttcggcgggcatcgaggagctcgcttacaaggtcgtggacctcgccaat
gccggccattcgcaattttcgccgctctaccccgacgagatgccgctcttccagaagatc
gagacgatcgcaaaggacatctatcacgcaagcgaggtgattgccgacaagctggtgcgc
gaacaactccggacctgggaagaccagggctatggcgatctgccgatctgcatggcgaag
acccaatattccttctccaccgacccgaacctgcgcggagcaccgacgggccacgccgtg
ccgatacgcgaggttcggctggccgccggggccggcttcatcgtcgtgataaccggcgag
atcatgacgatgcccggcctgccgaaggtgccttcttcggagcggatccggctgaacgag
caggggtacattgaagggttgttctga

DBGET integrated database retrieval system