KEGG   Sinorhizobium meliloti GR4: C770_GR4pC0382Help
Entry
C770_GR4pC0382    CDS       T02405                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00010  Glycolysis / Gluconeogenesis
smeg00053  Ascorbate and aldarate metabolism
smeg00071  Fatty acid degradation
smeg00280  Valine, leucine and isoleucine degradation
smeg00310  Lysine degradation
smeg00330  Arginine and proline metabolism
smeg00340  Histidine metabolism
smeg00380  Tryptophan metabolism
smeg00410  beta-Alanine metabolism
smeg00561  Glycerolipid metabolism
smeg00620  Pyruvate metabolism
smeg00625  Chloroalkane and chloroalkene degradation
smeg00903  Limonene and pinene degradation
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C770_GR4pC0382
   00053 Ascorbate and aldarate metabolism
    C770_GR4pC0382
   00620 Pyruvate metabolism
    C770_GR4pC0382
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C770_GR4pC0382
   00561 Glycerolipid metabolism
    C770_GR4pC0382
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C770_GR4pC0382
   00310 Lysine degradation
    C770_GR4pC0382
   00330 Arginine and proline metabolism
    C770_GR4pC0382
   00340 Histidine metabolism
    C770_GR4pC0382
   00380 Tryptophan metabolism
    C770_GR4pC0382
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C770_GR4pC0382
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C770_GR4pC0382
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C770_GR4pC0382
Enzymes [BR:smeg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C770_GR4pC0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AGA09107
Position
pRmeGR4c:complement(383442..384905)
Genome map
AA seq 487 aa AA seqDB search
MTLSFDPDTLPLPVGHFIDGRLVPAEGIIDMHRPSDGKPYAGCPLADEVLVDRAVETAKK
ALKATNWSGVRPRERTVVLQRWADLIESEAETLAKLEALSSTRPVGHLVAGDIAVSAEQI
RFFAEFADKEGSDLVPTDDSNLGMIMTEPYGVVGAITPWNFPVSMAAWKLGPALAAGNAV
VLKPSEMTPFSTVYLAELAIRAGLPAGLINIVLGDGPVTGTAMTGHPDIAKVSFTGSTGA
GTAIMTNVARTGIKPMTLELGGKSPQLVFADADLDKAAAAIAQSMLSNAGQACVAGSRLI
VEECIAAPLAEAIVTRMEAAKPGPTWDETSEYSPIISKRQLNRIHGIVEAAVEAGGECLF
GGAQMDAPGYFYQPTLMAVRDCSSPAITEEIFGPVLTMQTFADEEEALALADHPTYGLAA
GLFTRDLSRALGLTRRLQAGTVWVNRYSRSRDHILPTGGYKRSGIGKDLGREAYHANRKS
KSVLISL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacactcagctttgatccagacacacttcccctgcccgtcggccacttcatcgacggt
cggctggtgccggccgaaggcatcatcgacatgcatcgcccctccgatggcaagccttat
gcgggctgcccgcttgcggatgaggtgctcgtcgatcgcgccgtcgaaaccgccaagaag
gcgctcaaggcgaccaactggagcggcgtgcggccgcgcgagcgaacagtcgtgctgcag
cgctgggcagacctgatcgaaagcgaggcggaaaccctcgccaagctcgaggcgctttct
tcaacccggcccgttggtcatctcgtcgccggcgacattgcggtcagcgccgaacagatc
cgtttcttcgccgaattcgccgacaaggagggaagcgatctcgtgccaaccgacgacagc
aatctcggcatgatcatgaccgagccctatggcgtcgtcggtgccatcacgccctggaac
tttcccgtttccatggccgcctggaagctcggccccgcgctcgcggcaggcaatgcggtg
gtgctgaaaccctcggaaatgacgccgttctcgactgtctaccttgcggagctcgcgatc
cgcgccggtctgccggccggcctcatcaacatcgttctgggcgacggccccgtcaccggc
acggccatgaccggacacccggatatcgctaaggtgagcttcaccggctcgaccggcgcg
gggaccgctatcatgaccaacgtcgcccgcaccggcatcaagccgatgacgctggaactc
gggggaaaaagcccacaactggtcttcgccgatgccgatctcgacaaggcggcggcggcg
atcgcgcagagcatgctttcgaatgccggccaggcctgcgtcgctggctcccggctgatc
gtcgaagaatgcattgccgctcccctcgccgaagcgatcgtcacgcgcatggaggctgcg
aagccaggcccgacctgggacgagacgagcgaatactcgcccatcatttcgaagcgccag
ttgaaccgcatccacggcatcgtcgaggcggccgtcgaggcgggcggcgaatgcctgttc
ggtggcgcccaaatggatgcgccgggctatttctatcagccgacgctgatggccgtacgc
gactgctcctcgccggcgattaccgaggaaatcttcggcccggtgctcaccatgcagacc
ttcgccgacgaagaggaagcgctcgcgctcgccgatcacccgacctacggccttgccgcc
ggcctcttcacccgcgacctgtcgcgcgccctggggctgacgcgaagactccaggccgga
accgtctgggtcaaccgctacagccgctctcgcgaccacatcctgcctaccggcggctac
aagcgctccggcatcggcaaggatcttggccgcgaggcttaccacgccaaccgcaagagc
aagagcgtgctcatcagcctctag

DBGET integrated database retrieval system