KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1393Help
Entry
C770_GR4pD1393    CDS       T02405                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00010  Glycolysis / Gluconeogenesis
smeg00030  Pentose phosphate pathway
smeg00051  Fructose and mannose metabolism
smeg00680  Methane metabolism
smeg00710  Carbon fixation in photosynthetic organisms
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
smeg01200  Carbon metabolism
Module
smeg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C770_GR4pD1393
   00030 Pentose phosphate pathway
    C770_GR4pD1393
   00051 Fructose and mannose metabolism
    C770_GR4pD1393
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    C770_GR4pD1393
   00680 Methane metabolism
    C770_GR4pD1393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smeg04147]
    C770_GR4pD1393
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     C770_GR4pD1393
Exosome [BR:smeg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C770_GR4pD1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AGA11496
Position
pRmeGR4d:1533115..1534164
Genome map
AA seq 349 aa AA seqDB search
MSGATLEAYLASCTARGDDLSRDVAAVIQRLAKAALDIRKLVNQGALGTAFNGTHGGSNT
DGDLQKDLDILCDDQFLTCLQGAPVACYASEELENPVLLDPSARLAVAIDPLDGSSNIDN
NVSIGTIFSVLPAAKGPDVDPSQSFLQPGNRQLAAGFFIYGPQTALVLSLGKGTEIFIFS
SRLGCFVEAYKSAIIPERAHEFAINMSNYRHWEEAIRLYVDDCLAGSEGPRERDFNMRWI
ASLVAETYRILIRGGIFLYPADGRKGYSQGRLRLVYEANPIAFIIENAGGAATTSIDRIL
DLVPENLHQRVPLVFGSRREVARITRYHVDPNMIGERAPLFGKRGLFRA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgcgactctcgaagcttacctcgcttcatgcacggcccgcggcgacgacctt
tcacgggacgtcgccgccgtgatccagaggctggcgaaggccgccctcgacatccgcaag
ctcgtcaaccagggagcgctcggtaccgctttcaacggcacccacggcggcagcaacacg
gatggcgatctgcagaaggatctcgacatcctgtgcgacgaccaattcctgacgtgtctg
caaggcgcccccgtcgcatgctacgcctcggaagaactggaaaatccggttctgctcgac
ccgtcggcgcgcctcgcagttgccatcgacccgctcgacggctcttcgaacatcgataac
aacgtttccatcggcacgatcttctcggtgcttcccgccgccaaggggccggacgtggac
ccctcccagtccttcctgcaacctggaaaccggcaactggcggcgggcttctttatctac
ggaccgcagaccgctctggtcctgtcgctcggcaaggggacggagatcttcatcttctcc
agcaggctcggatgtttcgtcgaggcctacaagtcggccatcatcccggagcgcgcgcac
gaattcgccatcaacatgtcgaactaccggcactgggaagaagcgatccggctctatgtc
gacgactgcctggcaggctccgagggcccgcgcgagcgggatttcaacatgcgctggatc
gcctcgctcgtcgcggaaacctatcgcatcctcatccgcggcgggatctttctctatccc
gccgacggccggaagggatatagccagggccggctgcggctcgtctacgaggccaacccg
atcgccttcatcatcgagaatgccggcggcgcggccaccacgtccatcgaccgcattctc
gatctcgttccggaaaatctgcaccagcgcgtgcctctggttttcggttcgcgccgcgag
gtggcgcgcatcacccgctatcacgtcgacccgaacatgattggcgaacgcgctccgctc
ttcggcaagcgcggtctgttccgggcctga

DBGET integrated database retrieval system