KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1406Help
Entry
C770_GR4pD1406    CDS       T02405                                 

Definition
(GenBank) ABC-type nitrate/sulfonate/bicarbonate transport system, permease component
  KO
K02050  NitT/TauT family transport system permease protein
Organism
smeg  Sinorhizobium meliloti GR4
Module
smeg_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smeg02000]
    C770_GR4pD1406
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    C770_GR4pD1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGA11509
Position
pRmeGR4d:complement(1545522..1546253)
Genome map
AA seq 243 aa AA seqDB search
MRALSLGLLLLLWIAAAGFTDDASVLPQPWALWEPFVQAVSSGALPYHLGMTLWRVICAF
VPAMVIGVAIGFLMGRVAAVDRWLDPWLVVFLNLPALVLIVLCYIWIGLNETAAITAVVL
NKIPNVATLLREGARALDPDLDSMAAVYRMRPLARLRHVIMPQLAPFIAAAARSGIAVIW
KIVLVVEFLGRSSGIGFQIHFYFQLFNVAMVLVYALSFIGVMLLVEAFFLQPAERRVRRW
RTA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcattgtcgctggggctgctgttgctcttgtggatagcggccgccggcttcacg
gacgacgcgtcggtcctgccgcagccctgggcgctctgggaacccttcgtgcaagcggtc
agttccggcgccttgccctatcacctgggaatgacgctctggcgcgtgatctgcgcattc
gtgccggccatggtgatcggcgtggcgatcggctttctgatgggacgcgttgccgccgtg
gatcgatggctcgacccatggctagtcgtgtttctgaacctgccggcgctcgtgctcatc
gtgttgtgctacatctggatcggcctcaacgagacagccgccattaccgcggtggtgctc
aacaagatcccgaatgtcgcaacgcttctgcgcgagggcgcgagggcgctcgacccggac
ctcgactccatggcggcggtttaccgcatgcgtccgctggcgcggctgcgacacgtgatc
atgccgcagcttgcgcccttcattgccgctgccgcccggtccggcatcgcggtgatatgg
aagatcgtgctggtggtcgagtttctcggccgctccagcgggatcggattccagatccat
ttctatttccagcttttcaacgtcgccatggtgcttgtctatgcgctttccttcatcggc
gtgatgctgctggtggaggccttcttcctgcagccggccgaacgccgggtgcggcgctgg
aggacggcgtga

DBGET integrated database retrieval system