KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1407Help
Entry
C770_GR4pD1407    CDS       T02405                                 

Definition
(GenBank) ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic component
  KO
K02051  NitT/TauT family transport system substrate-binding protein
Organism
smeg  Sinorhizobium meliloti GR4
Module
smeg_M00188  NitT/TauT family transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smeg02000]
    C770_GR4pD1407
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    C770_GR4pD1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: AGA11510
Position
pRmeGR4d:complement(1546276..1547247)
Genome map
AA seq 323 aa AA seqDB search
MKTLRLIVAACLFAFGPAAASADELPQLRAAMLASGTVNWEISTIKTHEFDRKNGFELTV
QDYADNGATRVAFEGGEADTMVADWIWVANQRASGKDYVFIPYSRAVGGLMVKDDSGIKA
LPDLAGKKIGIAGGPLDKSWLILRAYARQQHDMDLAAETEQVFGAPPLIFKSALSGETAG
TINFWHFLAKMRAKGMHELVSVSDAAAALKLDPDTPLLGYVLKGEYAATHPEIVKGLYKA
SRAAKDLLSENDEVWEELRDKMNAADDAEFIALRDGYRAGIPSGKPIDEAAADRFLRLMA
ELGGEELVGKATSLPSGLFLHLE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttgagactgatcgtggccgcttgcctgttcgcattcggaccggctgcggcc
tcggccgacgagttgccgcagttgcgggcggccatgctggcatcgggaaccgtcaactgg
gaaatatccaccatcaagactcatgaattcgaccgcaagaacggttttgagctgacggtc
caggactatgcggacaacggcgcgacgcgcgttgccttcgagggcggcgaggccgacacc
atggtggccgactggatctgggtggccaaccagcgtgcctccggcaaggactatgttttc
atcccctattcgcgggcagtcggcggcctgatggtcaaggacgacagcggcatcaaggcg
ctgccggatcttgccggcaagaagatcggcattgccggaggtccgctcgacaagagctgg
ctgatcctgcgcgcctatgccaggcagcagcatgacatggaccttgcagccgaaaccgag
caggtgttcggcgccccgcctttgatcttcaagtcggcgctttcgggcgagacggcgggt
acgatcaatttctggcactttctcgcgaagatgagggccaagggcatgcatgaactggtc
tccgtctcggatgctgcggcggcgctcaagctcgatcccgatacgccgctgctcggttac
gtgttgaagggcgaatatgccgcgacccatccggaaatcgtgaaggggctttacaaggcc
tcgcgcgcggccaaggatctgctgagcgagaacgacgaggtgtgggaggaattgcgggac
aagatgaatgcggccgacgacgctgaattcattgccctgcgcgacggctatcgcgccggc
attccgagcggcaagccgatcgacgaggcggccgccgaccggtttctgcggctaatggcg
gaacttggtggagaagagctcgtcggcaaggcaacaagcctgcccagtggattgttcctg
caccttgaataa

DBGET integrated database retrieval system