KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1434Help
Entry
C770_GR4pD1434    CDS       T02405                                 

Definition
(GenBank) ABC-type sugar transport systems, ATPase component
  KO
K02010  iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg02010  ABC transporters
Module
smeg_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C770_GR4pD1434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smeg02000]
    C770_GR4pD1434
Enzymes [BR:smeg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.30  Fe3+-transporting ATPase
     C770_GR4pD1434
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    C770_GR4pD1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 SMC_N AAA AAA_16 TOBE_2 RsgA_GTPase TniB Rad17 UCR_14kD AAA_24 AAA_29 AAA_18 AAA_5 AAA_30 AAA_19 AAA_23 AAA_15 AAA_28
Motif
Other DBs
NCBI-ProteinID: AGA11537
Position
pRmeGR4d:complement(1570302..1571435)
Genome map
AA seq 377 aa AA seqDB search
MPTINLRGAQKNYGVNSANAVSNLDLEIRDGEFMCLLGPSGCGKTTTLRMIAGLENLSGG
EIRIGERVVDCVAGGVFVPPEKREMGLVFQSYALWPHLTIERNTDFGLRLRKLPKAEREE
RVERIMQALDIAKYRDRYPSQLSGGQQQRVALARMLAINPGVLLLDEPLSNLDARLRLEM
RAELKRLHKEFKTTIVFVTHDQWEAMTLATTIAVMNEGTLQQMGTPNDIYDRPANRFVAE
FVGSPPINILTFGQTGASDMADKADAYLAARCPQLTGVGSVGIRPEAIGYAMRIEDVPKG
SFSGETSVTGVLPTGGNWILELRSESHTLFLTTHVLPRIEQGARVFFFAPPEAMHVFDTG
GRRIAEADARLRSLAYN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgatcaacctgcgcggtgcgcagaagaactacggcgtgaattccgcgaacgcc
gtgtccaacctcgacctcgagatccgcgacggcgaattcatgtgccttctcggcccctcg
ggctgcgggaagaccacgacgctcagaatgattgccggactcgagaatctgtcgggcggc
gaaatcaggatcggcgaacgtgtggtcgactgcgtggccggcggggtcttcgtaccgccg
gagaagcgggagatgggcctcgtcttccaaagttatgccttgtggccgcatctgacgatc
gagcgcaacacggacttcggcctcagactgcggaagctccccaaagccgaaagggaggag
cgcgtcgagcgcatcatgcaggcgctcgatatcgccaaataccgggaccgttatccgtcg
caactgtccggcggccagcagcagcgagtggctcttgcccgcatgctggcgatcaacccc
ggcgtgctgctcctcgacgagccgctctccaatctcgatgcgcggttgcgcctggagatg
cgggcggagctcaagcggctacataaggaattcaagacgaccatcgtcttcgtcacccat
gatcaatgggaggcgatgacgctcgcgacgacgatcgcggtcatgaacgaggggactctg
cagcagatgggcacgccgaacgatatctacgatcgtccggcgaaccgcttcgtcgcagag
tttgtcggcagccccccgataaacatattgaccttcggtcagacgggtgcgtccgacatg
gccgacaaggcggacgcctatcttgccgcccgctgtccgcaactcacgggggtaggctcc
gtcggaatccgcccggaggcgatcggctatgcaatgcggatcgaggacgtgccgaagggc
agcttctccggcgagacatccgtgaccggcgttctgccgacgggaggcaactggatcctg
gagctcaggagcgagagccacaccctgttcctgacgacccatgttctgccgcggattgag
cagggcgccagagtgttcttcttcgcgccgcccgaggccatgcacgtgttcgacacgggt
ggccgccggatcgcggaggcggatgctcgattaagaagcctcgcctacaactga

DBGET integrated database retrieval system