KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1452Help
Entry
C770_GR4pD1452    CDS       T02405                                 

Definition
(GenBank) ABC-type dipeptide/oligopeptide/nickel transport systems, permease component
  KO
K02034  peptide/nickel transport system permease protein
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg02024  Quorum sensing
Module
smeg_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    C770_GR4pD1452
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    C770_GR4pD1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-ProteinID: AGA11555
Position
pRmeGR4d:1594610..1595533
Genome map
AA seq 307 aa AA seqDB search
MSLATTDNVIAAEPSFPVRMMRMLLADKFALCAAIFLLVILTIAIIGPAWLGDLATKQNL
RGRNLPPFDWTRTWVWWMGADALGRPLFARIIVAAQNTLMVAAGAVILSSVIGTVLGLIA
GFSSPRMSQIIMRLADVIMSFPSLLIAVIVLYVLGSSILNLMLVLAITRIPVYLRTTRAE
VLEIRERMFVQAARVMGASSKRILFRHILPVVLPTLTTLATLDFAYVMLAESALSFLGIG
IQPPEITWGLMISQGRQYLTNAWWLSFWPGLAIILTTMSLNLLSNWMRIALDPVQRWRLE
MKGGKNG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggcaaccaccgacaatgtcatcgccgcagagccgtccttcccggtccgcatg
atgcgcatgctgctggcggacaagttcgcgctctgcgcggcgatcttccttctcgtcatt
ctcaccatagccatcatcggtccggcctggctgggcgacctcgccacgaagcagaacctg
cgcggccgcaacctgccgccattcgactggacccgcacctgggtctggtggatgggggcc
gacgcgctcggccgtccgctcttcgcccgcatcatcgtggccgctcagaacaccctgatg
gtcgccgccggcgccgtgatcctctcctcggtgatcggcaccgttctcggcctcatcgcc
ggcttttcctcgccacgcatgagccagatcatcatgcgtctcgccgacgtgatcatgtcc
ttcccgtctctgctgatcgcggtgatcgtactctatgtgctcggctcctcgatcctcaac
ctcatgctggtgctcgccatcacccgcattccggtctatctgcgcaccacgcgcgccgaa
gtgctcgagatccgcgagcgcatgttcgtgcaggctgcccgggtcatgggcgcctccagc
aagcgaatcctgttccgccacatcctgccggtcgtgctgccgacgctgacgacgctcgcc
acgctcgatttcgcctatgtcatgctggcggagagcgcgctgtccttcctcggcatcggc
atccagccgccggaaatcacctggggcctgatgatctcgcagggccggcaatatctcacc
aatgcctggtggctctccttctggcccggccttgccatcattctcaccaccatgtcgctc
aacctgctgtccaactggatgcggatcgcgctcgatccggtacagcgctggcgtctcgaa
atgaagggcggcaaaaatggctga

DBGET integrated database retrieval system