KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1453Help
Entry
C770_GR4pD1453    CDS       T02405                                 

Definition
(GenBank) ATPase component of various ABC-type transport systems, containing duplicated ATPase
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg02024  Quorum sensing
Module
smeg_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C770_GR4pD1453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smeg02000]
    C770_GR4pD1453
Transporters [BR:smeg02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    C770_GR4pD1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N oligo_HPY AAA_22 AAA_21 AAA_29 AAA_25 AAA_16 RsgA_GTPase DUF87 NACHT IstB_IS21 Sigma54_activat AAA FtsK_SpoIIIE AAA_30 AAA_18 AAA_24 AAA_33 ABC_ATPase AAA_23 MMR_HSR1 NB-ARC DUF2813
Motif
Other DBs
NCBI-ProteinID: AGA11556
Position
pRmeGR4d:1595526..1597172
Genome map
AA seq 548 aa AA seqDB search
MAEHLLEVRNLSVEFHTAAGVVHAVKSISYHLDKGETLAILGESGSGKSVSSSAIMNLID
MPPGRISSGEILLDGRDLLTMPAEERREVNGRRVAMIFQDPLSHLNPVYSVGWQISEAMT
THGLAGSKAREEALRLLRRVGIPEPERAMRKYPHEFSGGQRQRVMIAMALALRPDLLIAD
EPTTALDVTVQAEVLKLLKELQRETGMAVLIITHDLGVVSEIADRVVVMEKGAIVEAGTV
REIYKNPQHPYTQKLIAAAPGKGAMHEPGARAEPLLSVRDVRKTYGSFEALKGISFDLMP
GETMAVVGESGSGKSTLARALLRLDEPDSGTALWKGRDLFALSPAELYKLRRDLQMVFQD
PTQSLNPRMTVYQLISEAWVIHPDILPKAKWRERVAELLVQVGLSAEHMSRYPHQFSGGQ
RQRIAIARALALEPQLIICDEAVSALDVSVQAQVIELLDRLRREMGIAFIFIAHDLPVVR
DFADYVMVMQQGEVVELGTVREVFDTPRQAYTRALLAASLSPDPDAKAGHLASVPAEAAD
ILIPKRSH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacatctgctcgaggtccgtaacctctccgtcgaattccacaccgcggcgggc
gtggtccatgcggtgaagtcgatctcctatcacctcgacaaaggcgagacgctggcaatc
ctcggcgaaagcggttccggcaagtccgtctcgtcctcggcgatcatgaacctcatcgac
atgccgccgggccgcatcagtagcggcgaaatcctgctcgacggcagggacctgctgacg
atgcctgccgaggaacggcgcgaagtcaacggccgccgggtcgccatgatctttcaggat
ccgctcagccacctcaatccggtctacagcgtcggctggcagatctccgaagccatgacc
actcacgggctcgccggcagcaaggcgcgcgaagaggcgctgcggctccttcgccgcgtc
ggaatccccgagcccgagcgggcaatgcgcaaatatccgcacgaattctccggcggtcag
cgccagcgcgtcatgatcgccatggcgctggcgctccggccggacctcctgatcgccgac
gaaccgaccaccgcgctggacgtgaccgtgcaggcggaagtgctgaagcttctgaaggaa
ctgcagcgcgaaacgggcatggcggtgctgatcatcacccacgatctcggcgtcgtctcc
gagatcgccgaccgggtcgtcgtgatggaaaagggcgccatcgtcgaagcgggaaccgtg
cgcgagatctacaagaacccgcagcatccctatacgcagaagctcatcgccgccgccccc
ggcaagggcgcgatgcacgaacccggcgcgcgcgccgaacccctgctcagcgtgcgcgac
gtgcgcaagacctacggctccttcgaagcgctgaagggcatctccttcgatctgatgccc
ggcgagaccatggctgtcgtcggagagagcggctccggcaaatcgacgcttgcccgggcc
cttttgcgtctcgatgagccggacagcggcacggcgctctggaagggccgcgacctgttc
gcgctttcgccggcagagctctacaagctcaggcgcgacctccagatggtgttccaggac
ccgacccagtcgctcaacccgcgcatgacggtctaccagctgatctccgaggcatgggtc
atccatccggacatcctgcccaaggcaaagtggcgtgaacgcgtcgcggagctcctggtg
caggtcggtctttcggccgagcacatgagccgctatccgcaccagttttccggcggccag
cggcagcgcatcgccattgcccgggcgcttgcgctcgagccgcagctgatcatctgcgac
gaggccgtttccgcgctcgacgtctccgtccaggcgcaggtgatcgagcttctcgacagg
ctgcgccgcgagatggggatcgccttcatcttcatcgcccatgacctgccggtcgttcgc
gatttcgccgattacgtcatggtcatgcagcagggagaggtcgtcgagctcggcaccgtc
cgcgaggtcttcgatacgccgcggcaggcctatacccgcgcccttctcgcggccagcctc
agtcccgatccggatgcaaaggccggccacctagcatcggtgccggccgaggctgccgac
attcttatcccaaagcggagtcactga

DBGET integrated database retrieval system