KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1454Help
Entry
C770_GR4pD1454    CDS       T02405                                 

Definition
(GenBank) Dihydrodipicolinate synthase/N-acetylneuraminate lyase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00261  Monobactam biosynthesis
smeg00300  Lysine biosynthesis
smeg01100  Metabolic pathways
smeg01110  Biosynthesis of secondary metabolites
smeg01120  Microbial metabolism in diverse environments
smeg01130  Biosynthesis of antibiotics
smeg01230  Biosynthesis of amino acids
Module
smeg_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    C770_GR4pD1454
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    C770_GR4pD1454
Enzymes [BR:smeg01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     C770_GR4pD1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AGA11557
Position
pRmeGR4d:1597172..1598053
Genome map
AA seq 293 aa AA seqDB search
MSKKAFVALVTCFNEDETINYEATRAQVRRQVAAGNNIMCAGTNGDFTALTHEEKIRLTE
EVIDEVGGRVDVIVNAGMPATFETLQLARAFDRIGVSGIAVITPFFIACTQDGLIRHFST
VADAVETPVYLYDIPSRTQNHIEPETALKLSAHGNIAGIKDSGGAQDTLEAYLQVARDVP
GFEVYSGPDHLVLWSLQNGAAGCISGLGNAMPEVLAGILSAFNSGNIAEAERQQAIYTAF
RTELYALGFPPALVKRSLYLQDPSVGASRQPALLPSEEQDAKIREILVRHRLL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaaagccttcgtcgccctcgtcacctgcttcaacgaggacgagaccatcaat
tacgaggcgacccgcgcccaggtacgccggcaggtcgccgccggcaacaatatcatgtgc
gccggcaccaatggcgacttcaccgcgctcacgcacgaagagaagatccgcctcaccgag
gaagtgatcgacgaggtcggcggccgcgtcgatgtcatcgtcaatgccggcatgcccgcg
accttcgagacgctgcagctcgcgcgcgccttcgaccgcatcggcgtcagcggcatcgcc
gtcatcacccccttcttcatcgcctgtacgcaggacggcctgatccggcacttctcgacg
gtcgccgatgccgtggagacccccgtctatctctatgacattccctcccgcacccagaac
catatcgagccggagacggcgttgaagctttccgcgcacggcaatatcgccgggatcaaa
gattccggcggtgcgcaggatacactcgaggcctatctgcaggtagcgcgcgacgtgccg
ggcttcgaagtctattccggcccggaccatctggttctctggtcgctgcagaacggtgcg
gccggctgcatttccggcctcggcaatgccatgccggaggtgctcgccggcattctcagc
gcgttcaacagcgggaacattgcggaggcggaacgccagcaggcaatctacaccgccttc
cgcaccgagctttacgccctcggcttcccgccggccctcgtcaagcgctcgctctacctg
caggatccctccgtcggcgcctcccgccagccggcactgcttccgagcgaggagcaggac
gcaaaaatccgcgaaattctggtgcggcaccggctgctgtga

DBGET integrated database retrieval system