KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1487Help
Entry
C770_GR4pD1487    CDS       T02405                                 

Definition
(GenBank) Transcriptional regulator
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR FCD Rrf2 MarR_2 HTH_Crp_2 HTH_41 HTH_11 TrmB Fe_dep_repress HTH_24 PaaX TFIIE_alpha HTH_5 HTH_CodY HTH_20 HTH_IclR HTH_29 HTH_AsnC-type Sigma70_r3 MarR
Motif
Other DBs
NCBI-ProteinID: AGA11590
Position
pRmeGR4d:complement(1634619..1635350)
Genome map
AA seq 243 aa AA seqDB search
MPEKSPILESLAEARPSSYADQVYGRILHDILNGIFQPGARLPTENELAERFGVSRPVVR
EALARLRVDGLVEARRGSGTYVLSRPSQDLPNLADLEDISRFLRYQELRFYVEGQAAALA
AERRTEKQLAAIIEAHEAFAHEVGRGAFLPESDRRFHLAICEGTGNEFFAKALEGPEVSL
TSFMNVSLALTRSGSQARARRVIAEHAEIVEAIRTKDAVWARVAMETHIINARRRMTDGT
IDS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagaagtcgcccatcctcgaaagcctagccgaagcccgcccgtcgagctatgcc
gatcaggtctacgggcgcatcctgcacgacatattgaacggcatctttcaaccgggcgca
cgtctgccgacggaaaacgaactcgccgaacgcttcggcgtctcgcggccggtcgtccgc
gaggcgcttgcgcgcctgcgggtcgacggcctcgtggaagcgcggcgcggcagcggcacc
tatgtcttgagcaggccctcgcaagatctgccgaacctggccgacctggaggatatttcg
cgcttcctgcgctatcaggagcttcgtttctacgtggaaggccaggcggcagcactggca
gcggagcggcgcacggaaaagcagcttgccgccattatcgaggcccatgaggccttcgcc
catgaggtcggccgcggggccttcctgccggaaagcgacaggcgtttccatcttgcgatc
tgcgaggggacgggaaacgagtttttcgccaaggcgctggagggcccggaggtttcgctg
accagcttcatgaacgtttcgcttgccctcacccggtccggatcgcaggcacgtgcccgc
cgggtcattgccgaacatgccgagatcgtcgaagcgatccgcacgaaagatgccgtatgg
gcgcgggtggcgatggaaacgcacatcatcaacgcgcgccgaaggatgacggacggtaca
atcgactcctga

DBGET integrated database retrieval system