KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1488Help
Entry
C770_GR4pD1488    CDS       T02405                                 

Definition
(GenBank) Transcriptional regulator
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR HTH_24 PaaX HTH_20 LexA_DNA_bind HTH_28 MarR_2 MarR TrmB
Motif
Other DBs
NCBI-ProteinID: AGA11591
Position
pRmeGR4d:1635458..1636162
Genome map
AA seq 234 aa AA seqDB search
MTSEAPAAKHRSGLDRTRQIAPQIVEYLRERILALDLAPGTALSRVELQKQFGLSQTPVR
DALMRLEEEGLVTVYPQYATLVSKIDINLARQTHLMRRAVEQEAVFNLAEKANRGQIADR
LRVANTKLKALASKEHAEFLAADRAFHFIIFEEAGLEHIWPIIRRHSGHIDRLRRLNLVN
VGTKRVVDTHDMIIEGIEKGAPVEAAQAMKTHLSGTLSMIDDIAARYPDYIELG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgacatcggaagctccggctgccaaacatcgcagcggccttgaccgcacccggcagatc
gcgccgcaaatcgtggaatatcttcgcgagaggatcctcgcgctcgacctcgcccccggt
acggcgctctcgcgtgtcgaactgcagaaacagttcggtctcagccagacgccggtgcgt
gacgcgctgatgcgcctggaggaggagggcctcgtcaccgtctacccgcaatatgcgacg
ctggtctccaaaatcgatatcaatctggcccgccagacccacctcatgcgccgtgcggtc
gagcaggaagccgtcttcaatctggcggaaaaggccaacaggggacagatcgcagaccgg
ctgcgagtggcgaacaccaagctgaaagccctcgcttcgaaggaacatgcggagtttctc
gcggccgaccgtgcgtttcacttcatcatcttcgaggaagcggggctggagcacatctgg
ccgatcatccgccgccacagcggccatatcgatcgtctgcggcgcctcaatctcgtcaat
gtcggcaccaaacgtgtggtggacacccacgacatgatcatcgaagggatcgaaaagggt
gcgccggtcgaggcagcgcaagcgatgaagacccacctctccggcacgttgtcgatgatc
gacgacatcgcggcgcgttatccggattacatagaactcgggtag

DBGET integrated database retrieval system