KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1513Help
Entry
C770_GR4pD1513    CDS       T02405                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenase
Organism
smeg  Sinorhizobium meliloti GR4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGA11616
Position
pRmeGR4d:complement(1659582..1660751)
Genome map
AA seq 389 aa AA seqDB search
MKALTWHGKGDIRCESVPDPKIEDDRDAVIKVTACAICGSDVHIFHGLIPSMENGDILGH
ETMGEVVEVGKAATGLQVGDRVVVPFTIACGECFFCRKGFYSACERTNPDREKAAKLWGN
SPAGLFGYSHLLGGYSGGQAEYLRVPHADVGPIKVPDELTDEQALFLSDIFPTGYMAAEF
CNIEPGQTIAIWGCGPVGQMAIRSAFLLGAERVIAIDTIAERLRLAESAGAMTLDYMAED
IYDRIMEITHGRGADACIDAVGTEADSRASLDSLVDRVKVVTFMGTDRPHVLRQAIHCCR
NFGTVSVVGVYGGYLDKVPLGSAINRGLTLRMAQTPVQRYLPSLLDRIRKGEIDPSFVVT
HRGGLDDGPELYKTFAERTDGCIKVVLRP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccctgacatggcacggcaaaggcgatatccgttgcgagagcgtgcccgatccg
aagatcgaggatgaccgcgacgccgtcatcaaggtcaccgcctgtgcgatttgcggatcg
gacgttcatatttttcacggcctcattccatccatggagaatggcgacattctcggccat
gaaaccatgggtgaggttgtggaggtcggcaaggccgcgaccggactgcaggtcggcgac
cgggtggtcgttccgttcaccatcgcctgcggcgagtgcttcttctgccggaaaggcttc
tactccgcctgcgagcgaaccaatcccgaccgggaaaaggcggcgaagctctggggcaat
tcgccggcgggcctctttggctactcccatctcctcggcggctatagcggcggacaggcg
gagtatctgcgcgtgccgcacgcagatgtcgggccgatcaaggttcccgacgaactcacg
gacgagcaggcgctcttcctctccgatattttcccaacgggctacatggcggcggagttc
tgcaacatcgaacccgggcagacgattgcgatctggggctgcggcccagtcgggcagatg
gcgatccgctcggcattcctgctcggcgccgaacgggtcatcgccatcgatacgatcgcg
gagcgcctgaggcttgccgagtccgccggcgccatgacactcgactacatggctgaggat
atctacgaccgcatcatggagatcacccacggccggggcgcagacgcctgcatcgacgcc
gtgggcacggaggccgacagccgggcaagcctcgattcgctcgtcgaccgcgtgaaggtg
gtgaccttcatgggaacggatcggccccatgtgttgcggcaggcgatccattgctgcagg
aatttcggcacggtttccgtcgtcggcgtctatggcggctatctcgacaaggtaccgctc
ggttcggcgatcaatcgcggcctgacgctccggatggcccagacccccgttcagcgctat
ttgccttcgctcctggaccgcatccggaagggcgagatcgatccgtccttcgtggtgacc
caccgcggcgggctcgacgacggccccgaactctacaagactttcgcggaaagaacggac
ggctgcataaaggtcgtcctgaggccctga

DBGET integrated database retrieval system