KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1525Help
Entry
C770_GR4pD1525    CDS       T02405                                 

Definition
(GenBank) Sulfate permease and related transporters (MFS superfamily)
  KO
K03321  sulfate permease, SulP family
Organism
smeg  Sinorhizobium meliloti GR4
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smeg02000]
    C770_GR4pD1525
Transporters [BR:smeg02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   C770_GR4pD1525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfate_transp STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: AGA11628
Position
pRmeGR4d:1673012..1674499
Genome map
AA seq 495 aa AA seqDB search
MKTTITSYKREWFSNIRGDVLSGIVVALALIPEAIGFSVIAGVDPKVGLFASFAIACVSA
FAGGRPGMISAATAATAVLMVTLVKEHGLEYLFAATLLMGLIQIAAGFLKLGRVMRFVSR
SVITGFVNALAILIFMAQLPELIGVPHVTYAMIAAGLGIIYLFPYVTKAVPSPLVAIAVL
TAVAFWTGMDVRTVGDLGALPSSLPIFALPQVPLTFETLQIIFPYSVALAAVGLLESLLT
AQIVDDMTDTTSNKSQECIGQGASNIASGLIGGMGGCAMIGQSVINVTSGGRGRLSTFVA
GAFLLFLILVLDDLVRIIPMAALVAVMIMVSVGTFSWRSILDLRRNPLPSSVVMLATVVT
TVGTHDLAKGVLVGVLLSGVFFAGKVARLFHVRSMLDESGKVRTYHVDGQIFFASTEGFI
AAFDFAEPLDKVVIDVGEAHLWDITAVGALDKVVLKYRRHGVTVEVIGLNEASAHMLDRF
AVHDKSEGTALTATH
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacgattaccagctataaacgcgaatggttctccaacatccgcggcgacgtc
ctttcgggcattgtcgtggcgcttgcgctgataccggaggcgatcggcttctcggtcatt
gcaggcgtcgatccgaaggtcggcctgttcgcctccttcgccattgcctgcgtttccgcc
ttcgccggcggccgcccgggcatgatctcggcggcgaccgccgccaccgccgtcctgatg
gtcacgcttgtcaaggaacacggcctcgaatatctctttgccgccaccctgctgatgggg
ctcatccagatcgccgcaggcttcctgaagctcggccgggtgatgcgcttcgtctcccgt
tcggtcatcaccggcttcgtcaatgcgcttgcgatcttgatcttcatggcgcagcttccg
gaactcatcggtgtgccgcatgtcacctatgcgatgatcgcggcagggctcgggatcatc
tacctctttccctatgtcacgaaggcggttccctcgccgctcgtcgcgatcgccgtgctg
accgcggtcgccttctggaccggaatggacgtccgcaccgtcggcgacctcggcgcattg
ccgtcgagcctgccgatcttcgcgctgccgcaggtgccgctcaccttcgagacgctgcag
atcatcttcccctactcggtggcgcttgccgccgtagggctgctcgaatcccttttgacc
gctcagatcgtcgacgacatgacggacacgacgagcaacaagagccaggaatgcatcggc
caaggcgcaagcaacatcgcctccggcctcatcggcgggatgggcggctgcgccatgatc
ggccagtcggtgatcaacgtgacctccggcggacgcgggcggctctcgaccttcgtcgcc
ggcgccttccttctcttcctcatcctcgtcctcgacgacctcgtccgcatcattccgatg
gccgcactcgtcgccgtgatgatcatggtctcggtcggcaccttctcctggcgctccatc
ctcgacctgcgccgcaatcccctgccttcctccgtcgtgatgttggcaacggtcgtcacc
accgtcggcacccacgatctcgcaaagggcgtcctggtcggggtgcttctgtcgggggtg
ttcttcgccggaaaggtcgcccgcctcttccatgtccgctcgatgctcgacgagagcgga
aaggtgcgtacctatcatgtcgacggccagatcttcttcgcctcgaccgaggggttcatc
gccgccttcgacttcgcggaaccgctggacaaggtcgtcatcgacgtcggcgaggcgcat
ctgtgggacatcaccgcagtcggcgcactggacaaggtggtgctcaaatatcgccgccac
ggtgtcaccgtcgaggtgatcggcctcaacgaggcaagcgctcatatgctcgaccgcttc
gccgtgcacgacaagagcgaaggcacggcgctcaccgcaacacattga

DBGET integrated database retrieval system